StarFunc result for job id P16219

User Input

>input (412 residues)
MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQV
DKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLN
GTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTAN
LIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAF
GAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KSD5	0.980	0.980	1.553E-64	412	1.000	1.000	E5KSD5.pdb.gz	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
2	AFDB:Q3ZBF6	0.961	0.961	7.291E-61	412	0.898	0.898	Q3ZBF6.pdb.gz	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
3	PDB:1jqiA	0.928	0.996	9.014E-57	384	0.852	0.914	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
4	AFDB:G3KIM8	0.904	0.945	1.312E-39	394	0.434	0.454	G3KIM8.pdb.gz	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
5	AFDB:A0A0S2Z3P9	0.902	0.861	5.118E-38	432	0.396	0.377	A0A0S2Z3P9.pdb.gz	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
6	AFDB:P70584	0.895	0.854	9.425E-38	432	0.367	0.350	P70584.pdb.gz	ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadsb PE=1 SV=1
7	AFDB:C8VQF1	0.908	0.853	2.301E-37	439	0.391	0.367	C8VQF1.pdb.gz	C8VQF1_EMENI Acyl-CoA dehydrogenase, putative (AFU_orthologue AFUA_1G14850) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00824 PE=3 SV=1
8	AFDB:P9WQG1	0.889	0.941	3.857E-37	389	0.403	0.427	P9WQG1.pdb.gz	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
9	AFDB:G5EEH6	0.925	0.909	1.248E-36	419	0.371	0.365	G5EEH6.pdb.gz	G5EEH6_CAEEL Isovaleryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ivd-1 PE=1 SV=1
10	AFDB:H6LGM6	0.900	0.977	1.308E-36	379	0.422	0.459	H6LGM6.pdb.gz	CARC_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarC OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carC PE=1 SV=1
11	AFDB:Q95U46	0.901	0.897	8.168E-36	414	0.342	0.341	Q95U46.pdb.gz	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
12	PDB:6fahC	0.893	0.970	3.436E-34	379	0.420	0.456	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
13	PDB:1ivhA	0.895	0.952	4.773E-34	387	0.342	0.364	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
14	PDB:1rx0A	0.895	0.959	1.061E-33	384	0.340	0.365	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
15	PDB:2a1tC	0.907	0.962	1.472E-32	388	0.352	0.374	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
16	PDB:7s7gA	0.840	0.612	7.950E-28	571	0.328	0.236	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
17	PDB:2r0mA	0.864	0.912	7.941E-27	390	0.279	0.295	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
18	PDB:2ix6A	0.858	0.850	1.849E-26	416	0.267	0.264	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
19	PDB:6af6A	0.884	0.949	1.849E-26	383	0.250	0.269	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
20	PDB:3d9dA	0.826	0.790	9.978E-21	432	0.204	0.194	3d9dA.pdb.gz	Crystal structures of intermediates in the nitroalkane oxidase reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5KSD5	0.0	845	412	1.000	1.000	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
2	E9PE82	0.0	729	408	0.893	0.902	E9PE82_HUMAN Acyl-CoA dehydrogenase short chain OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
3	P15651	0.0	756	412	0.879	0.879	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
4	P16219	0.0	845	412	1.000	1.000	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
5	Q07417	0.0	758	412	0.883	0.883	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
6	Q3ZBF6	0.0	734	412	0.898	0.898	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
7	G3KIM8	4.46e-118	351	394	0.437	0.457	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
8	H6LGM6	3.68e-115	343	379	0.422	0.459	CARC_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarC OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carC PE=1 SV=1
9	P9WQG1	3.61e-104	315	389	0.415	0.440	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
10	A0A0S2Z3P9	9.45e-96	295	432	0.374	0.356	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
11	P45954	9.45e-96	295	432	0.374	0.356	ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1
12	H2KZG6	5.79e-94	290	427	0.369	0.356	H2KZG6_CAEEL Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-1 PE=1 SV=1
13	Q9I296	4.35e-91	281	387	0.376	0.401	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
14	Q9FS88	2.72e-90	280	412	0.362	0.362	MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum OX=4113 GN=2MBCD PE=1 SV=2
15	Q9VVU1	5.40e-90	280	414	0.345	0.343	Q9VVU1_DROME FI09602p OS=Drosophila melanogaster OX=7227 GN=GH07925p PE=1 SV=1
16	C8VQF1	7.63e-90	280	439	0.371	0.349	C8VQF1_EMENI Acyl-CoA dehydrogenase, putative (AFU_orthologue AFUA_1G14850) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00824 PE=3 SV=1
17	P70584	1.47e-89	279	432	0.347	0.331	ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadsb PE=1 SV=1
18	Q95U46	1.89e-89	278	414	0.342	0.341	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
19	Q9DBL1	2.01e-89	279	432	0.352	0.336	ACDSB_MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadsb PE=1 SV=1
20	G5EEH6	2.33e-89	278	419	0.388	0.382	G5EEH6_CAEEL Isovaleryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ivd-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	6e-46	167.8	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	9.8e-20	82.6	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	1.7e-23	93.9	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	1.1e-33	127.6	Acyl-CoA dehydrogenase, N-terminal domain
5	PF11794 HpaB_N	1.1e+02	13.9	4-hydroxyphenylacetate 3-hydroxylase N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242592

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357535	0.992	Enoyl-CoA hydratase, mitochondrial
2	9606.ENSP00000285093	0.987	3-ketoacyl-CoA thiolase, mitochondrial
3	9606.ENSP00000370023	0.984	Trifunctional enzyme subunit alpha, mitochondrial
4	9606.ENSP00000325136	0.983	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
5	9606.ENSP00000333664	0.981	3-ketoacyl-CoA thiolase, peroxisomal
6	9606.ENSP00000265838	0.976	Acetyl-CoA acetyltransferase, mitochondrial
7	9606.ENSP00000450436	0.975	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
8	9606.ENSP00000231887	0.970	Peroxisomal bifunctional enzyme
9	9606.ENSP00000356015	0.966	Acetyl-CoA acetyltransferase, cytosolic
10	9606.ENSP00000436585	0.955	Ethylmalonyl-CoA decarboxylase
11	9606.ENSP00000365462	0.954	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
12	9606.ENSP00000289416	0.940	Acyl-coenzyme A synthetase ACSM3, mitochondrial
13	9606.ENSP00000419027	0.931	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
14	9606.ENSP00000327453	0.926	Acyl-coenzyme A synthetase ACSM2B, mitochondrial
15	9606.ENSP00000459451	0.926	Acyl-coenzyme A synthetase ACSM2A, mitochondrial
16	9606.ENSP00000382349	0.925	Acyl-coenzyme A synthetase ACSM4, mitochondrial
17	9606.ENSP00000222214	0.924	Glutaryl-CoA dehydrogenase, mitochondrial
18	9606.ENSP00000253382	0.923	Acetyl-coenzyme A synthetase, cytoplasmic
19	9606.ENSP00000316924	0.923	Acetyl-coenzyme A synthetase 2-like, mitochondrial
20	9606.ENSP00000449535	0.914	Acyl-CoA synthetase short-chain family member 3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003995	0.998	acyl-CoA dehydrogenase activity
GO:0005488	0.988	binding
GO:0005515	0.953	protein binding
GO:0050660	0.823	flavin adenine dinucleotide binding
GO:0042802	0.303	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016054	0.996	organic acid catabolic process
GO:0019395	0.995	fatty acid oxidation
GO:0006635	0.993	fatty acid beta-oxidation
GO:0006807	0.340	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.948	nucleus
GO:0031981	0.913	nuclear lumen
GO:0005759	0.910	mitochondrial matrix
GO:0043232	0.663	intracellular non-membrane-bounded organelle
GO:0005654	0.439	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.998	Acting on the CH-CH group of donors.

[back to server]