StarFunc result for job id P16220

User Input

>input (327 residues)
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q803K8	0.427	0.437	5.277E-37	318	0.887	0.912	Q803K8.pdb.gz	Q803K8_DANRE Creb1 protein OS=Danio rerio OX=7955 GN=creb1 PE=1 SV=1
2	AFDB:P27699	0.379	0.356	2.916E-24	357	0.642	0.588	P27699.pdb.gz	CREM_MOUSE cAMP-responsive element modulator OS=Mus musculus OX=10090 GN=Crem PE=1 SV=2
3	AFDB:Q3KR79	0.313	0.291	1.883E-19	355	0.538	0.496	Q3KR79.pdb.gz	Q3KR79_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
4	AFDB:F8VYN3	0.232	0.349	1.398E-16	200	0.373	0.610	F8VYN3.pdb.gz	F8VYN3_HUMAN Activating transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=1
5	AFDB:Q84LG2	0.201	0.170	8.470E-2	389	0.226	0.190	Q84LG2.pdb.gz	BZP68_ARATH bZIP transcription factor 68 OS=Arabidopsis thaliana OX=3702 GN=BZIP68 PE=1 SV=1
6	PDB:7nkyO	0.068	0.053	1.856E-1	427	0.021	0.016	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
7	AFDB:A0A1I6CMA8	0.185	0.204	3.214E-1	291	0.119	0.134	A0A1I6CMA8.pdb.gz	A0A1I6CMA8_CAEEL BZIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zip-9 PE=1 SV=1
8	PDB:5juyB	0.104	0.034	3.945E-1	1234	0.046	0.012	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
9	PDB:7fikj	0.091	0.038	5.587E-1	1028	0.043	0.014	7fikj.pdb.gz
10	PDB:7oa6B	0.084	0.154	6.648E-1	152	0.049	0.105	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
11	PDB:4gq2P	0.091	0.084	7.911E-1	371	0.028	0.024	4gq2P.pdb.gz
12	AFDB:Q96GS4	0.191	0.178	9.128E-1	357	0.150	0.137	Q96GS4.pdb.gz	BORC6_HUMAN BLOC-1-related complex subunit 6 OS=Homo sapiens OX=9606 GN=BORCS6 PE=1 SV=2
13	PDB:6xt9I	0.102	0.055	9.414E-1	767	0.018	0.008	6xt9I.pdb.gz
14	AFDB:Q98TA5	0.119	0.047	1.025	896	0.187	0.068	Q98TA5.pdb.gz	CA1AA_XENLA Chromatin assembly factor 1 subunit A-A OS=Xenopus laevis OX=8355 GN=chaf1a-a PE=1 SV=1
15	PDB:5lj5t	0.091	0.076	1.057	438	0.067	0.050	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
16	AFDB:Q9ES28	0.146	0.062	1.220	862	0.098	0.037	Q9ES28.pdb.gz	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
17	PDB:2qzwA	0.048	0.046	1.258	341	0.031	0.029	2qzwA.pdb.gz
18	PDB:6n61D	0.077	0.026	1.258	1239	0.055	0.015	6n61D.pdb.gz	Structural mechanism of transcription inhibition by lasso peptides microcin J25 and capistruin.
19	PDB:7ajuUL	0.088	0.039	1.258	779	0.031	0.013	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	AFDB:Q06507	0.212	0.199	1.370	349	0.177	0.166	Q06507.pdb.gz	ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 OS=Mus musculus OX=10090 GN=Atf4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15337	0.0	651	327	0.991	0.991	CREB1_RAT Cyclic AMP-responsive element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Creb1 PE=1 SV=2
2	P16220	0.0	656	327	1.000	1.000	CREB1_HUMAN Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=3
3	Q01147	0.0	655	327	0.997	0.997	CREB1_MOUSE Cyclic AMP-responsive element-binding protein 1 OS=Mus musculus OX=10090 GN=Creb1 PE=1 SV=2
4	Q53X93	0.0	656	327	1.000	1.000	Q53X93_HUMAN CREB1 protein (Fragment) OS=Homo sapiens OX=9606 GN=CREB1 PE=2 SV=1
5	Q5U0J5	0.0	648	341	1.000	0.959	Q5U0J5_HUMAN cAMP responsive element binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=2 SV=1
6	Q803K8	0.0	564	318	0.887	0.912	Q803K8_DANRE Creb1 protein OS=Danio rerio OX=7955 GN=creb1 PE=1 SV=1
7	Q9W618	0.0	647	327	0.985	0.985	Q9W618_TAEGU CREB OS=Taeniopygia guttata OX=59729 PE=2 SV=1
8	C9J896	3.35e-180	499	251	0.768	1.000	C9J896_HUMAN cAMP responsive element binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=1
9	P27699	6.63e-129	374	357	0.661	0.605	CREM_MOUSE cAMP-responsive element modulator OS=Mus musculus OX=10090 GN=Crem PE=1 SV=2
10	Q03061	6.70e-129	374	357	0.661	0.605	CREM_RAT cAMP-responsive element modulator OS=Rattus norvegicus OX=10116 GN=Crem PE=1 SV=2
11	Q03060	1.73e-126	367	345	0.645	0.612	CREM_HUMAN cAMP-responsive element modulator OS=Homo sapiens OX=9606 GN=CREM PE=1 SV=6
12	P18846	4.97e-102	302	271	0.474	0.572	ATF1_HUMAN Cyclic AMP-dependent transcription factor ATF-1 OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=2
13	P81269	1.60e-98	293	269	0.529	0.643	ATF1_MOUSE Cyclic AMP-dependent transcription factor ATF-1 OS=Mus musculus OX=10090 GN=Atf1 PE=1 SV=1
14	F7FD47	1.75e-96	288	268	0.465	0.567	F7FD47_RAT Activating transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Atf1 PE=4 SV=1
15	Q5BK34	2.13e-94	286	348	0.465	0.437	Q5BK34_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
16	Q3KR79	2.36e-94	286	355	0.465	0.428	Q3KR79_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
17	C9JBT4	1.74e-93	277	170	0.508	0.976	C9JBT4_HUMAN cAMP responsive element binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=1
18	F8VYN3	3.88e-61	195	200	0.312	0.510	F8VYN3_HUMAN Activating transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=1
19	F8VS03	3.43e-49	164	170	0.260	0.500	F8VS03_HUMAN Activating transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=1
20	Q9U2I0	8.46e-29	115	327	0.153	0.153	CREBH_CAEEL CREB homolog crh-1 OS=Caenorhabditis elegans OX=6239 GN=crh-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	1.7e-15	68.2	bZIP transcription factor
2	PF07716 bZIP_2	0.0019	29.6	Basic region leucine zipper
3	PF03131 bZIP_Maf	14	17.6	bZIP Maf transcription factor
4	PF02173 pKID	4e-18	75.9	pKID domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9913.ENSBTAP00000007201

Rank	PPI partner	STRING score	Description
1	9913.ENSBTAP00000005092	0.999	Bos taurus CREB binding protein (CREBBP), mRNA
2	9913.ENSBTAP00000021556	0.999	E1A binding protein p300
3	9913.ENSBTAP00000050880	0.998	CREB-regulated transcription coactivator 2
4	9913.ENSBTAP00000014487	0.990	Ribosomal protein S6 kinase, 90kDa, polypeptide 5
5	9913.ENSBTAP00000002963	0.987	Activating transcription factor 2
6	9913.ENSBTAP00000045317	0.981	Uncharacterized protein
7	9913.ENSBTAP00000046899	0.970	Belongs to the protein kinase superfamily.
8	9913.ENSBTAP00000046803	0.962	cAMP-dependent protein kinase catalytic subunit beta
9	9913.ENSBTAP00000005279	0.960	Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28. Binds to the USP28 promoter
10	9913.ENSBTAP00000021507	0.958	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
11	9913.ENSBTAP00000055835	0.955	Uncharacterized protein
12	9913.ENSBTAP00000027518	0.954	Class II, major histocompatibility complex, transactivator
13	9913.ENSBTAP00000005660	0.953	Proto-oncogene c-Fos
14	9913.ENSBTAP00000023461	0.949	AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported (By similarity). AKT is responsible of the regulation of glucose uptake by mediating insulin- induced translocation of the SLC2A4/GLUT4 glucose tran [...]
15	9913.ENSBTAP00000048844	0.949	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
16	9913.ENSBTAP00000008727	0.945	cAMP-dependent protein kinase catalytic subunit alpha
17	9913.ENSBTAP00000020910	0.942	Ribosomal protein S6 kinase, 90kDa, polypeptide 4
18	9913.ENSBTAP00000013704	0.941	Bos taurus CREB regulated transcription coactivator 1 (CRTC1), mRNA
19	9913.ENSBTAP00000001972	0.931	Huntingtin
20	9913.ENSBTAP00000056184	0.928	Methyl-CpG-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.990	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.643	DNA-binding transcription activator activity
GO:0001228	0.617	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0019222	0.974	regulation of metabolic process
GO:0042221	0.972	response to chemical
GO:0048522	0.961	positive regulation of cellular process
GO:0051716	0.953	cellular response to stimulus
GO:0007154	0.948	cell communication
GO:0009893	0.946	positive regulation of metabolic process
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0080090	0.941	regulation of primary metabolic process
GO:0031323	0.941	regulation of cellular metabolic process
GO:0010468	0.932	regulation of gene expression
GO:0051171	0.930	regulation of nitrogen compound metabolic process
GO:0023052	0.921	signaling
GO:0010033	0.882	response to organic substance
GO:0051252	0.872	regulation of RNA metabolic process
GO:0010556	0.865	regulation of macromolecule biosynthetic process
GO:2001141	0.856	regulation of RNA biosynthetic process
GO:0006355	0.838	regulation of DNA-templated transcription
GO:0010604	0.817	positive regulation of macromolecule metabolic process
GO:0008152	0.813	metabolic process
GO:0032501	0.802	multicellular organismal process
GO:0031325	0.801	positive regulation of cellular metabolic process
GO:0051173	0.798	positive regulation of nitrogen compound metabolic process
GO:0006357	0.740	regulation of transcription by RNA polymerase II
GO:0031328	0.631	positive regulation of cellular biosynthetic process
GO:0044238	0.571	primary metabolic process
GO:0007165	0.567	signal transduction
GO:0045944	0.558	positive regulation of transcription by RNA polymerase II
GO:1901698	0.484	response to nitrogen compound
GO:0071704	0.483	organic substance metabolic process
GO:1901700	0.477	response to oxygen-containing compound
GO:0044237	0.377	cellular metabolic process
GO:0010243	0.350	response to organonitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.953	protein-containing complex
GO:0005654	0.952	nucleoplasm
GO:0043232	0.512	intracellular non-membrane-bounded organelle
GO:0005667	0.360	transcription regulator complex
GO:0005737	0.341	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]