StarFunc result for job id P16260

User Input

>input (332 residues)
MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRV
KVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTL
ITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYA
KEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKT
HVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL
YRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16260	1.000	1.000	8.517E-46	332	1.000	1.000	P16260.pdb.gz	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
2	AFDB:F4HW79	0.767	0.769	1.454E-19	331	0.377	0.378	F4HW79.pdb.gz	COAC1_ARATH Mitochondrial carrier protein CoAc1 OS=Arabidopsis thaliana OX=3702 GN=COAC1 PE=2 SV=1
3	AFDB:P38702	0.817	0.763	4.588E-19	357	0.364	0.339	P38702.pdb.gz	LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEU5 PE=1 SV=1
4	AFDB:B4F8I5	0.765	0.758	1.275E-18	335	0.370	0.367	B4F8I5.pdb.gz	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
5	AFDB:Q6I583	0.799	0.750	1.645E-18	355	0.334	0.313	Q6I583.pdb.gz	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
6	AFDB:K7VYZ9	0.772	0.755	2.986E-18	340	0.370	0.362	K7VYZ9.pdb.gz	COAC1_MAIZE Mitochondrial carrier protein CoAc1 OS=Zea mays OX=4577 GN=COAC1 PE=2 SV=1
7	AFDB:Q6NUK1	0.760	0.541	2.986E-18	477	0.307	0.214	Q6NUK1.pdb.gz	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
8	AFDB:F4JU70	0.779	0.781	3.251E-18	331	0.328	0.329	F4JU70.pdb.gz	COAC2_ARATH Mitochondrial carrier protein CoAc2 OS=Arabidopsis thaliana OX=3702 GN=COAC2 PE=2 SV=1
9	AFDB:Q9BV35	0.790	0.567	1.217E-17	468	0.286	0.203	Q9BV35.pdb.gz	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
10	AFDB:A0A024R7K2	0.773	0.806	1.442E-17	318	0.361	0.377	A0A024R7K2.pdb.gz
11	PDB:4c9qB	0.686	0.778	5.524E-12	290	0.238	0.272	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.689	0.773	2.349E-11	293	0.256	0.290	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.474	0.523	1.730E-9	292	0.247	0.281	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:1qoyA	0.124	0.133	1.986E-1	303	0.072	0.079	1qoyA.pdb.gz
15	PDB:7oseB	0.172	0.160	3.454E-1	377	0.105	0.093	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
16	PDB:3kcuA	0.159	0.192	3.605E-1	252	0.102	0.135	3kcuA.pdb.gz	Structure of the formate transporter FocA reveals a pentameric aquaporin-like channel
17	PDB:3hd6A	0.179	0.158	4.096E-1	403	0.139	0.114	3hd6A.pdb.gz
18	PDB:7ehlA	0.166	0.117	4.274E-1	563	0.130	0.076	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
19	PDB:1k62B	0.146	0.117	4.653E-1	459	0.108	0.078	1k62B.pdb.gz
20	PDB:5mkkB	0.158	0.105	4.653E-1	577	0.127	0.073	5mkkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16260	0.0	681	332	1.000	1.000	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
2	Q8C0K5	0.0	608	332	0.873	0.873	GDC_MOUSE Solute carrier family 25 member 16 OS=Mus musculus OX=10090 GN=Slc25a16 PE=1 SV=1
3	B4F8I5	4.38e-68	218	335	0.377	0.373	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
4	K7VYZ9	9.48e-67	215	340	0.367	0.359	COAC1_MAIZE Mitochondrial carrier protein CoAc1 OS=Zea mays OX=4577 GN=COAC1 PE=2 SV=1
5	F4HW79	2.40e-64	208	331	0.370	0.372	COAC1_ARATH Mitochondrial carrier protein CoAc1 OS=Arabidopsis thaliana OX=3702 GN=COAC1 PE=2 SV=1
6	P38702	2.58e-64	209	357	0.367	0.342	LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEU5 PE=1 SV=1
7	F4JU70	5.61e-63	205	331	0.355	0.356	COAC2_ARATH Mitochondrial carrier protein CoAc2 OS=Arabidopsis thaliana OX=3702 GN=COAC2 PE=2 SV=1
8	Q0P483	1.88e-62	203	321	0.383	0.396	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1
9	Q6I583	4.57e-59	195	355	0.349	0.327	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
10	Q86VD7	9.95e-57	188	318	0.364	0.381	S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens OX=9606 GN=SLC25A42 PE=1 SV=2
11	Q6NUK1	7.10e-56	190	477	0.322	0.224	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
12	Q8R0Y8	3.45e-55	184	318	0.367	0.384	S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus OX=10090 GN=Slc25a42 PE=1 SV=1
13	Q8BMD8	3.96e-55	188	475	0.322	0.225	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
14	Q12251	2.97e-54	182	326	0.334	0.340	YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPR011C PE=1 SV=1
15	F4JHS4	1.32e-53	181	366	0.343	0.311	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
16	Q6GQS1	3.75e-53	183	467	0.307	0.218	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1
17	Q9VDL7	1.20e-52	179	365	0.337	0.307	Q9VDL7_DROME Dephosphocoenzyme A carrier, isoform A OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=2 SV=2
18	A0A0B4LIE8	1.87e-52	178	364	0.337	0.308	A0A0B4LIE8_DROME Dephosphocoenzyme A carrier, isoform D OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=3 SV=1
19	Q9BV35	3.64e-52	180	468	0.310	0.220	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
20	Q8IN53	4.71e-52	175	290	0.334	0.383	Q8IN53_DROME Dephosphocoenzyme A carrier, isoform B OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	2e-68	237.7	Mitochondrial carrier protein
2	PF18405 SLC25_like	0.8	20.2	Mitochondrial SLC25 homolog

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000476815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342056	0.832	Citrate synthase, mitochondrial
2	9606.ENSP00000348299	0.815	E3 ubiquitin-protein ligase TRIM13
3	9606.ENSP00000351619	0.632	Phenazine biosynthesis like protein domain containing
4	9606.ENSP00000373420	0.557	RUN and FYVE domain containing 2
5	9606.ENSP00000351185	0.542	DNA replication ATP-dependent helicase/nuclease DNA2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	1.000	transmembrane transporter activity
GO:0015291	0.993	secondary active transmembrane transporter activity
GO:0008514	0.976	organic anion transmembrane transporter activity
GO:0015932	0.878	nucleobase-containing compound transmembrane transporter activity
GO:0015605	0.877	organophosphate ester transmembrane transporter activity
GO:0015215	0.847	nucleotide transmembrane transporter activity
GO:0005488	0.795	binding
GO:0015216	0.494	purine nucleotide transmembrane transporter activity
GO:0005515	0.474	protein binding
GO:0000295	0.366	adenine nucleotide transmembrane transporter activity
GO:1901702	0.345	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.957	metabolic process
GO:0044237	0.918	cellular metabolic process
GO:0071704	0.871	organic substance metabolic process
GO:0006807	0.752	nitrogen compound metabolic process
GO:0044238	0.685	primary metabolic process
GO:0065007	0.514	biological regulation
GO:1901564	0.459	organonitrogen compound metabolic process
GO:0050789	0.417	regulation of biological process
GO:0050794	0.317	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.956	membrane
GO:0031090	0.918	organelle membrane
GO:0031967	0.666	organelle envelope
GO:0005740	0.663	mitochondrial envelope
GO:0031966	0.491	mitochondrial membrane
GO:0005743	0.345	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]