StarFunc result for job id P16284

User Input

>input (738 residues)
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16284	1.000	1.000	0.000	738	1.000	1.000	P16284.pdb.gz	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
2	AFDB:P51866	0.688	0.688	9.176E-93	739	0.698	0.697	P51866.pdb.gz	PECA1_BOVIN Platelet endothelial cell adhesion molecule OS=Bos taurus OX=9913 GN=PECAM1 PE=1 SV=1
3	AFDB:Q3SWT0	0.727	0.784	1.612E-87	678	0.603	0.656	Q3SWT0.pdb.gz	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
4	AFDB:Q925N6	0.168	0.103	5.504E-29	1320	0.165	0.092	Q925N6.pdb.gz	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
5	AFDB:A0A0B4K7N1	0.197	0.160	5.585E-22	986	0.164	0.123	A0A0B4K7N1.pdb.gz	A0A0B4K7N1_DROME Sidestep, isoform C OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
6	AFDB:A0A2R8QL08	0.238	0.110	2.948E-19	2036	0.138	0.050	A0A2R8QL08.pdb.gz
7	PDB:5oj2B	0.213	0.224	2.991E-19	692	0.134	0.143	5oj2B.pdb.gz
8	AFDB:Q0E9F2	0.220	0.132	7.077E-19	1542	0.127	0.061	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
9	PDB:1e07A	0.225	0.250	8.635E-19	642	0.112	0.129	1e07A.pdb.gz
10	AFDB:A8WH79	0.182	0.164	9.351E-18	866	0.117	0.099	A8WH79.pdb.gz	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
11	AFDB:Q90478	0.147	0.103	5.910E-17	1197	0.145	0.089	Q90478.pdb.gz	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
12	PDB:5a42A	0.141	0.075	1.143E-16	1597	0.085	0.039	5a42A.pdb.gz
13	PDB:7q1yA	0.136	0.085	1.200E-15	1374	0.080	0.043	7q1yA.pdb.gz
14	PDB:4ziqA	0.139	0.079	1.992E-15	1450	0.089	0.046	4ziqA.pdb.gz
15	PDB:4lnvA	0.130	0.082	6.306E-15	1276	0.085	0.049	4lnvA.pdb.gz
16	AFDB:M0RC17	0.161	0.107	2.060E-14	1210	0.150	0.092	M0RC17.pdb.gz	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
17	PDB:7q5zA	0.139	0.088	2.632E-14	1344	0.081	0.045	7q5zA.pdb.gz
18	PDB:4rtdA	0.117	0.082	3.634E-14	1122	0.089	0.059	4rtdA.pdb.gz
19	PDB:7sqcO0	0.176	0.138	6.319E-14	1140	0.088	0.057	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:6h03A	0.134	0.091	2.297E-13	1223	0.100	0.061	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16284	0.0	1536	738	1.000	1.000	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
2	P51866	0.0	962	739	0.699	0.698	PECA1_BOVIN Platelet endothelial cell adhesion molecule OS=Bos taurus OX=9913 GN=PECAM1 PE=1 SV=1
3	Q08481	0.0	945	727	0.625	0.634	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
4	Q3SWT0	0.0	890	678	0.595	0.647	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
5	Q96RD9	5.15e-23	107	977	0.206	0.156	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
6	Q96P31	1.21e-16	86.7	734	0.140	0.140	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
7	Q96PJ5	1.30e-13	76.3	515	0.129	0.184	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
8	Q96LA5	3.68e-13	75.1	508	0.157	0.228	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
9	Q68SN8	1.33e-11	70.1	596	0.134	0.166	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
10	P31809	9.29e-10	64.3	521	0.111	0.157	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
11	A0A8I6ASH2	1.15e-09	64.7	4387	0.129	0.022	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
12	A0A8I6A2S5	1.36e-09	64.3	4402	0.129	0.022	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
13	D3YXG0	5.36e-09	62.4	5634	0.125	0.016	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
14	Q8WZ42	9.25e-09	62.0	34350	0.115	0.002	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	Q0GKX6	1.23e-08	60.8	775	0.103	0.098	Q0GKX6_ICTPU Leukocyte immune-type receptor TS32.15 L1.1a (Fragment) OS=Ictalurus punctatus OX=7998 PE=2 SV=1
16	G5EDG4	1.62e-08	60.8	3962	0.106	0.020	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
17	Q7TN00	1.71e-08	60.8	3410	0.108	0.023	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
18	A0A8I5ZUN3	1.75e-08	60.8	35375	0.108	0.002	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	A2ASS6	2.49e-08	60.5	35213	0.118	0.002	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
20	G5EG33	2.91e-08	60.1	5198	0.106	0.015	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	10	17.7	Immunoglobulin C2-set domain
2	PF07679 I-set	5e-09	47.4	Immunoglobulin I-set domain
3	PF00047 ig	4.5e-18	76.5	Immunoglobulin domain
4	PF13895 Ig_2	2.5e-42	154.4	Immunoglobulin domain
5	PF13927 Ig_3	3e-28	109.5	Immunoglobulin domain
6	PF18452 Ig_6	5.5	18.3	Immunoglobulin domain
7	PF17736 Ig_C17orf99	7.3e-17	72.5	C17orf99 Ig domain
8	PF16706 Izumo-Ig	0.00079	30.6	Izumo-like Immunoglobulin domain
9	PF15807 MAP17	12	17.4	Membrane-associated protein 117 kDa, PDZK1-interacting protein 1
10	PF13908 Shisa	1.3e+02	14.0	Wnt and FGF inhibitory regulator
11	PF07686 V-set	1.5e-05	36.5	Immunoglobulin V-set domain
12	PF08204 V-set_CD47	1.2e+02	14.1	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000263923	0.998	Vascular endothelial growth factor receptor 2
3	9606.ENSP00000344115	0.998	Cadherin-5
4	9606.ENSP00000344456	0.998	Catenin beta-1
5	9606.ENSP00000362680	0.998	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000479536	0.997	CD177 antigen
7	9606.ENSP00000226279	0.991	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
8	9606.ENSP00000391592	0.988	Tyrosine-protein phosphatase non-receptor type 6
9	9606.ENSP00000452786	0.974	Integrin beta-3
10	9606.ENSP00000313681	0.968	Sphingosine kinase 1
11	9606.ENSP00000027335	0.961	Cadherin-17
12	9606.ENSP00000261023	0.960	Integrin alpha-V
13	9606.ENSP00000346671	0.958	Tyrosine-protein kinase Fyn
14	9606.ENSP00000411355	0.958	Receptor-type tyrosine-protein phosphatase C
15	9606.ENSP00000462468	0.957	Tyrosine-protein kinase Yes
16	9606.ENSP00000286548	0.954	Guanine nucleotide-binding protein G(q) subunit alpha
17	9606.ENSP00000310036	0.950	Hematopoietic progenitor cell antigen CD34
18	9606.ENSP00000337825	0.948	Tyrosine-protein kinase Lck
19	9606.ENSP00000355645	0.944	Actin, alpha skeletal muscle
20	9606.ENSP00000428924	0.944	Tyrosine-protein kinase Lyn

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0005102	0.815	signaling receptor binding
GO:0019899	0.448	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0032501	0.992	multicellular organismal process
GO:0050896	0.990	response to stimulus
GO:0019222	0.986	regulation of metabolic process
GO:0048856	0.979	anatomical structure development
GO:0048518	0.974	positive regulation of biological process
GO:0051716	0.972	cellular response to stimulus
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0051174	0.969	regulation of phosphorus metabolic process
GO:0048522	0.960	positive regulation of cellular process
GO:0007275	0.957	multicellular organism development
GO:0009893	0.956	positive regulation of metabolic process
GO:0016477	0.953	cell migration
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0030154	0.939	cell differentiation
GO:0048731	0.937	system development
GO:0042325	0.926	regulation of phosphorylation
GO:0007165	0.925	signal transduction
GO:0001932	0.919	regulation of protein phosphorylation
GO:0010604	0.917	positive regulation of macromolecule metabolic process
GO:0030334	0.910	regulation of cell migration
GO:0007155	0.905	cell adhesion
GO:0031325	0.892	positive regulation of cellular metabolic process
GO:0051173	0.884	positive regulation of nitrogen compound metabolic process
GO:0045937	0.860	positive regulation of phosphate metabolic process
GO:0002376	0.855	immune system process
GO:0051247	0.853	positive regulation of protein metabolic process
GO:0050730	0.840	regulation of peptidyl-tyrosine phosphorylation
GO:0001934	0.833	positive regulation of protein phosphorylation
GO:0009888	0.825	tissue development
GO:0050900	0.817	leukocyte migration
GO:0071840	0.816	cellular component organization or biogenesis
GO:0016043	0.808	cellular component organization
GO:0003158	0.785	endothelium development
GO:0048468	0.783	cell development
GO:2000147	0.764	positive regulation of cell motility
GO:0030335	0.749	positive regulation of cell migration
GO:0098609	0.741	cell-cell adhesion
GO:0050731	0.731	positive regulation of peptidyl-tyrosine phosphorylation
GO:0048519	0.701	negative regulation of biological process
GO:0045446	0.680	endothelial cell differentiation
GO:0001885	0.664	endothelial cell development
GO:0048513	0.540	animal organ development
GO:0048583	0.505	regulation of response to stimulus
GO:0006950	0.453	response to stress
GO:0007166	0.443	cell surface receptor signaling pathway
GO:0042221	0.431	response to chemical
GO:0048523	0.416	negative regulation of cellular process
GO:0065009	0.396	regulation of molecular function
GO:0072359	0.390	circulatory system development
GO:0032879	0.342	regulation of localization
GO:0001944	0.339	vasculature development
GO:0010468	0.319	regulation of gene expression
GO:0048584	0.313	positive regulation of response to stimulus
GO:0051239	0.300	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043229	0.998	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0032991	0.989	protein-containing complex
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0031982	0.978	vesicle
GO:0005576	0.972	extracellular region
GO:0031090	0.946	organelle membrane
GO:0065010	0.945	extracellular membrane-bounded organelle
GO:0070062	0.941	extracellular exosome
GO:0031410	0.930	cytoplasmic vesicle
GO:0070161	0.749	anchoring junction
GO:0030141	0.733	secretory granule
GO:0098588	0.727	bounding membrane of organelle
GO:0012506	0.717	vesicle membrane
GO:0030667	0.710	secretory granule membrane
GO:0031091	0.601	platelet alpha granule
GO:0009986	0.587	cell surface
GO:0005911	0.579	cell-cell junction
GO:0070013	0.485	intracellular organelle lumen
GO:0031092	0.477	platelet alpha granule membrane
GO:0005829	0.422	cytosol
GO:0031981	0.340	nuclear lumen
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]