StarFunc result for job id P16333

User Input

>input (377 residues)
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4Y3	0.637	0.637	1.690E-69	377	1.000	1.000	A0A0S2Z4Y3.pdb.gz	A0A0S2Z4Y3_HUMAN NCK adaptor protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=2 SV=1
2	AFDB:D4A3M8	0.630	0.626	5.847E-56	380	0.682	0.676	D4A3M8.pdb.gz	D4A3M8_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck2 PE=1 SV=1
3	AFDB:Q9VPU1	0.259	0.178	4.881E-41	548	0.462	0.318	Q9VPU1.pdb.gz	Q9VPU1_DROME Dreadlocks, isoform B OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
4	AFDB:Q95PX0	0.400	0.385	1.832E-38	397	0.424	0.403	Q95PX0.pdb.gz	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
5	AFDB:A0A0S2Z4E4	0.295	0.456	2.842E-38	244	0.647	1.000	A0A0S2Z4E4.pdb.gz	A0A0S2Z4E4_HUMAN NCK adaptor protein 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
6	AFDB:M9ND00	0.247	0.097	2.675E-19	1190	0.257	0.082	M9ND00.pdb.gz	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
7	AFDB:Q8INU2	0.282	0.122	1.314E-18	1014	0.186	0.069	Q8INU2.pdb.gz	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
8	AFDB:A0A0S2Z4D7	0.215	0.410	2.038E-18	170	0.350	0.776	A0A0S2Z4D7.pdb.gz	A0A0S2Z4D7_HUMAN NCK adaptor protein 1 isoform 2 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
9	AFDB:Q9Z0R6	0.162	0.041	2.159E-17	1659	0.223	0.051	Q9Z0R6.pdb.gz	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
10	AFDB:Q15811	0.232	0.071	2.689E-17	1721	0.183	0.040	Q15811.pdb.gz	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
11	PDB:1k9aB	0.219	0.188	1.647E-12	441	0.138	0.118	1k9aB.pdb.gz
12	PDB:1griA	0.220	0.383	1.191E-10	211	0.143	0.256	1griA.pdb.gz
13	PDB:2h8hA	0.234	0.199	3.771E-10	445	0.119	0.101	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:2lqnA	0.154	0.188	2.881E-8	303	0.103	0.129	2lqnA.pdb.gz
15	PDB:4gwfA	0.244	0.186	7.736E-8	497	0.093	0.070	4gwfA.pdb.gz
16	PDB:5xzrA	0.244	0.178	1.862E-7	519	0.093	0.067	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
17	PDB:2eyzA	0.155	0.185	2.734E-7	304	0.122	0.151	2eyzA.pdb.gz
18	PDB:3ps5A	0.239	0.174	5.580E-7	529	0.125	0.089	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
19	PDB:8dcxB	0.231	0.358	6.968E-6	236	0.066	0.106	8dcxB.pdb.gz
20	PDB:3qwyA	0.158	0.345	1.023E-5	170	0.074	0.165	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4Y3	0.0	782	377	1.000	1.000	A0A0S2Z4Y3_HUMAN NCK adaptor protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=2 SV=1
2	B2RZ33	0.0	780	377	0.992	0.992	B2RZ33_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck1 PE=1 SV=1
3	D4A3M8	0.0	534	380	0.690	0.684	D4A3M8_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck2 PE=1 SV=1
4	O43639	0.0	546	380	0.703	0.697	NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=2
5	O55033	0.0	534	380	0.690	0.684	NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus OX=10090 GN=Nck2 PE=1 SV=1
6	P16333	0.0	782	377	1.000	1.000	NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
7	Q99M51	0.0	780	377	0.989	0.989	NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus OX=10090 GN=Nck1 PE=1 SV=1
8	Q24218	1.80e-110	331	410	0.467	0.429	Q24218_DROME SH2/SH3 adaptor protein OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
9	Q8IPW2	2.24e-110	330	410	0.467	0.429	Q8IPW2_DROME Dreadlocks, isoform A OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
10	Q9VPU1	7.75e-109	331	548	0.467	0.321	Q9VPU1_DROME Dreadlocks, isoform B OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
11	C9J869	5.14e-91	272	162	0.353	0.821	C9J869_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
12	A0A0S2Z4D7	1.92e-90	271	170	0.353	0.782	A0A0S2Z4D7_HUMAN NCK adaptor protein 1 isoform 2 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
13	A0A0S2Z4E4	1.02e-89	272	244	0.374	0.578	A0A0S2Z4E4_HUMAN NCK adaptor protein 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
14	Q95PW9	4.36e-88	273	395	0.448	0.428	Q95PW9_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
15	Q95PX0	5.44e-88	273	397	0.448	0.426	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
16	C9JVV5	8.28e-88	263	129	0.342	1.000	C9JVV5_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
17	H7C5C7	2.12e-79	241	141	0.316	0.844	H7C5C7_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
18	E7ERP6	8.25e-38	132	83	0.159	0.723	E7ERP6_HUMAN NCK adaptor protein 2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=1
19	Q8INU2	9.64e-24	105	1014	0.172	0.064	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
20	M9PDC7	9.88e-24	105	1005	0.172	0.065	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	11	17.9	Helically-extended SH3 domain
2	PF00017 SH2	2.2e-20	83.9	SH2 domain
3	PF14633 SH2_2	23	15.8	SH2 domain
4	PF00018 SH3_1	5.6e-41	149.2	SH3 domain
5	PF17902 SH3_10	0.0037	28.6	SH3 domain
6	PF07653 SH3_2	1.7e-29	112.7	Variant SH3 domain
7	PF08239 SH3_3	0.00084	31.0	Bacterial SH3 domain
8	PF14604 SH3_9	1.1e-35	132.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000025725

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021603	0.996	Lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
2	9593.ENSGGOP00000003101	0.994	P21 protein (Cdc42/Rac)-activated kinase 1
3	9593.ENSGGOP00000007089	0.983	P21 protein (Cdc42/Rac)-activated kinase 2
4	9593.ENSGGOP00000014405	0.972	NCK adaptor protein 2
5	9593.ENSGGOP00000004531	0.971	Wiskott-Aldrich syndrome
6	9593.ENSGGOP00000017210	0.969	Wiskott-Aldrich syndrome-like
7	9593.ENSGGOP00000012526	0.955	Kinase insert domain receptor (a type III receptor tyrosine kinase)
8	9593.ENSGGOP00000028097	0.950	NPHS1, nephrin
9	9593.ENSGGOP00000017349	0.948	Cbl proto-oncogene, E3 ubiquitin protein ligase
10	9593.ENSGGOP00000005010	0.942	P21 protein (Cdc42/Rac)-activated kinase 7
11	9593.ENSGGOP00000007195	0.939	DCC netrin 1 receptor
12	9593.ENSGGOP00000011974	0.936	Vav 1 guanine nucleotide exchange factor
13	9593.ENSGGOP00000010577	0.934	Mitogen-activated protein kinase kinase kinase kinase 4
14	9593.ENSGGOP00000006207	0.933	Docking protein 1, 62kDa (downstream of tyrosine kinase 1)
15	9593.ENSGGOP00000025988	0.933	Uncharacterized protein
16	9593.ENSGGOP00000007465	0.929	Receptor protein-tyrosine kinase
17	9593.ENSGGOP00000007098	0.920	Platelet-derived growth factor receptor beta
18	9593.ENSGGOP00000018950	0.912	BCAR1, Cas family scaffolding protein
19	9593.ENSGGOP00000000203	0.905	Docking protein 2, 56kDa
20	9593.ENSGGOP00000016367	0.905	WAS/WASL interacting protein family, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031369	1.000	translation initiation factor binding
GO:0019899	0.872	enzyme binding
GO:0005102	0.789	signaling receptor binding
GO:0019900	0.707	kinase binding
GO:0019901	0.475	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050896	0.979	response to stimulus
GO:0048522	0.977	positive regulation of cellular process
GO:0009966	0.973	regulation of signal transduction
GO:0048523	0.972	negative regulation of cellular process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0019220	0.961	regulation of phosphate metabolic process
GO:0051716	0.951	cellular response to stimulus
GO:0031399	0.943	regulation of protein modification process
GO:0110053	0.938	regulation of actin filament organization
GO:1902905	0.937	positive regulation of supramolecular fiber organization
GO:0051495	0.937	positive regulation of cytoskeleton organization
GO:0008064	0.926	regulation of actin polymerization or depolymerization
GO:0001932	0.918	regulation of protein phosphorylation
GO:0030833	0.918	regulation of actin filament polymerization
GO:0010604	0.915	positive regulation of macromolecule metabolic process
GO:0031325	0.911	positive regulation of cellular metabolic process
GO:0051173	0.883	positive regulation of nitrogen compound metabolic process
GO:0010563	0.880	negative regulation of phosphorus metabolic process
GO:0045936	0.873	negative regulation of phosphate metabolic process
GO:0030838	0.873	positive regulation of actin filament polymerization
GO:0031400	0.866	negative regulation of protein modification process
GO:0042326	0.857	negative regulation of phosphorylation
GO:0007154	0.850	cell communication
GO:0007165	0.840	signal transduction
GO:0048584	0.831	positive regulation of response to stimulus
GO:0001933	0.825	negative regulation of protein phosphorylation
GO:0032501	0.816	multicellular organismal process
GO:0080135	0.815	regulation of cellular response to stress
GO:1902531	0.810	regulation of intracellular signal transduction
GO:0006950	0.809	response to stress
GO:0031326	0.798	regulation of cellular biosynthetic process
GO:0051247	0.747	positive regulation of protein metabolic process
GO:0010468	0.728	regulation of gene expression
GO:0010556	0.694	regulation of macromolecule biosynthetic process
GO:0023056	0.664	positive regulation of signaling
GO:0032502	0.650	developmental process
GO:2000112	0.624	regulation of cellular macromolecule biosynthetic process
GO:0008152	0.615	metabolic process
GO:0010647	0.610	positive regulation of cell communication
GO:0071704	0.608	organic substance metabolic process
GO:0044237	0.600	cellular metabolic process
GO:0051239	0.567	regulation of multicellular organismal process
GO:0044238	0.565	primary metabolic process
GO:0007166	0.551	cell surface receptor signaling pathway
GO:1905897	0.519	regulation of response to endoplasmic reticulum stress
GO:0006807	0.514	nitrogen compound metabolic process
GO:0048856	0.475	anatomical structure development
GO:0043170	0.447	macromolecule metabolic process
GO:0097581	0.433	lamellipodium organization
GO:0007169	0.413	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010941	0.390	regulation of cell death
GO:1901564	0.382	organonitrogen compound metabolic process
GO:1902533	0.377	positive regulation of intracellular signal transduction
GO:1900101	0.354	regulation of endoplasmic reticulum unfolded protein response
GO:0048585	0.351	negative regulation of response to stimulus
GO:0002682	0.350	regulation of immune system process
GO:0019538	0.310	protein metabolic process
GO:0042127	0.305	regulation of cell population proliferation
GO:0042981	0.304	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0071944	0.999	cell periphery
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005886	0.960	plasma membrane
GO:0012505	0.916	endomembrane system
GO:0031982	0.899	vesicle
GO:0030054	0.868	cell junction
GO:0070161	0.645	anchoring junction
GO:0032991	0.379	protein-containing complex
GO:0043228	0.365	non-membrane-bounded organelle
GO:0043232	0.364	intracellular non-membrane-bounded organelle
GO:0005634	0.341	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]