StarFunc result for job id P16401

User Input

>input (226 residues)
MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGL
SLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAK
PKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAA
AKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16401	1.000	1.000	1.057E-30	226	1.000	1.000	P16401.pdb.gz	H15_HUMAN Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3
2	AFDB:P43277	0.659	0.673	6.806E-22	221	0.823	0.842	P43277.pdb.gz	H13_MOUSE Histone H1.3 OS=Mus musculus OX=10090 GN=H1-3 PE=1 SV=2
3	AFDB:P15865	0.660	0.678	4.302E-21	219	0.814	0.840	P15865.pdb.gz	H14_RAT Histone H1.4 OS=Rattus norvegicus OX=10116 GN=H1-4 PE=1 SV=3
4	AFDB:P16402	0.736	0.750	1.318E-20	221	0.783	0.801	P16402.pdb.gz	H13_HUMAN Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2
5	AFDB:Q02539	0.374	0.390	1.166E-16	215	0.650	0.684	Q02539.pdb.gz	H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3
6	AFDB:A5PK20	0.454	0.485	1.974E-16	210	0.690	0.743	A5PK20.pdb.gz	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
7	AFDB:P06350	0.433	0.469	1.024E-15	207	0.633	0.691	P06350.pdb.gz	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
8	AFDB:P43275	0.370	0.390	1.424E-15	213	0.624	0.662	P43275.pdb.gz	H11_MOUSE Histone H1.1 OS=Mus musculus OX=10090 GN=H1-1 PE=1 SV=2
9	AFDB:P22492	0.391	0.423	1.861E-13	207	0.491	0.536	P22492.pdb.gz	H1T_HUMAN Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4
10	AFDB:P06349	0.439	0.473	2.268E-13	208	0.522	0.567	P06349.pdb.gz	H1T_RAT Histone H1t OS=Rattus norvegicus OX=10116 GN=H1-6 PE=1 SV=2
11	PDB:7k5yU	0.320	0.931	9.116E-10	75	0.310	0.933	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
12	PDB:6l9zS	0.280	0.693	1.465E-3	84	0.137	0.369	6l9zS.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
13	PDB:7kbfK	0.275	0.738	1.786E-3	78	0.088	0.256	7kbfK.pdb.gz	Structural features of nucleosomes in interphase and metaphase chromosomes.
14	PDB:6labV	0.267	0.505	5.470E-3	109	0.155	0.321	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
15	PDB:2fe3B	0.243	0.370	8.693E-2	143	0.053	0.084	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
16	PDB:2g9wA	0.249	0.453	2.844E-1	119	0.044	0.084	2g9wA.pdb.gz
17	PDB:3euhB	0.212	0.157	3.953E-1	321	0.044	0.031	3euhB.pdb.gz
18	PDB:5oqj2	0.223	0.134	3.953E-1	395	0.053	0.030	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
19	PDB:4etsB	0.239	0.347	4.222E-1	149	0.044	0.067	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
20	PDB:4a6dA	0.205	0.138	4.510E-1	345	0.062	0.041	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16401	4.77e-133	375	226	1.000	1.000	H15_HUMAN Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3
2	A5PK20	4.16e-50	164	210	0.664	0.714	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
3	P16402	5.41e-47	156	221	0.540	0.552	H13_HUMAN Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2
4	P10412	1.32e-46	155	219	0.456	0.470	H14_HUMAN Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2
5	P16403	4.16e-46	154	213	0.407	0.432	H12_HUMAN Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2
6	P43276	1.59e-45	152	223	0.451	0.457	H15_MOUSE Histone H1.5 OS=Mus musculus OX=10090 GN=H1-5 PE=1 SV=2
7	P15865	1.87e-45	152	219	0.451	0.466	H14_RAT Histone H1.4 OS=Rattus norvegicus OX=10116 GN=H1-4 PE=1 SV=3
8	P43274	4.31e-45	151	219	0.447	0.461	H14_MOUSE Histone H1.4 OS=Mus musculus OX=10090 GN=H1-4 PE=1 SV=2
9	P43277	6.09e-41	141	221	0.451	0.462	H13_MOUSE Histone H1.3 OS=Mus musculus OX=10090 GN=H1-3 PE=1 SV=2
10	P02253	4.22e-40	138	213	0.434	0.460	H12_BOVIN Histone H1.2 OS=Bos taurus OX=9913 GN=H1-2 PE=1 SV=2
11	P15864	4.49e-39	135	212	0.345	0.368	H12_MOUSE Histone H1.2 OS=Mus musculus OX=10090 GN=H1-2 PE=1 SV=2
12	P22492	6.94e-38	132	207	0.482	0.527	H1T_HUMAN Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4
13	P06350	1.13e-35	127	207	0.265	0.290	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
14	Q02539	3.45e-34	123	215	0.363	0.381	H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3
15	P06349	9.77e-33	119	208	0.372	0.404	H1T_RAT Histone H1t OS=Rattus norvegicus OX=10116 GN=H1-6 PE=1 SV=2
16	P43275	1.59e-30	114	213	0.363	0.385	H11_MOUSE Histone H1.1 OS=Mus musculus OX=10090 GN=H1-1 PE=1 SV=2
17	Q07133	2.92e-30	113	208	0.544	0.591	H1T_MOUSE Histone H1t OS=Mus musculus OX=10090 GN=H1-6 PE=1 SV=4
18	Q08GK9	2.62e-15	73.2	178	0.173	0.219	HSPL_MULSU Protamine-like protein OS=Mullus surmuletus OX=87757 GN=pl PE=1 SV=2
19	P02255	1.91e-13	69.7	256	0.261	0.230	H1_DROME Histone H1 OS=Drosophila melanogaster OX=7227 GN=His1 PE=1 SV=1
20	Q80ZM5	3.93e-11	62.0	188	0.155	0.186	Q80ZM5_MOUSE H1 histone family, member X OS=Mus musculus OX=10090 GN=H1f10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00538 Linker_histone	3e-18	77.2	linker histone H1 and H5 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372170	0.975	Homeobox protein MSX-1
2	9606.ENSP00000332194	0.955	Histone H2A type 2-C
3	9606.ENSP00000365380	0.939	Forkhead box protein P3
4	9606.ENSP00000266970	0.930	Cyclin-dependent kinase 2
5	9606.ENSP00000296503	0.923	High mobility group protein B2
6	9606.ENSP00000345347	0.918	High mobility group protein B1
7	9606.ENSP00000261366	0.916	Lamin-B1
8	9606.ENSP00000269305	0.914	Cellular tumor antigen p53
9	9606.ENSP00000378699	0.911	Cyclin-dependent kinase 1
10	9606.ENSP00000358151	0.904	Histone H2B type 2-E
11	9606.ENSP00000374213	0.902	E1A-binding protein p400
12	9606.ENSP00000267163	0.900	Retinoblastoma-associated protein
13	9606.ENSP00000475814	0.870	Histone H2A type 2-A
14	9606.ENSP00000262643	0.851	G1/S-specific cyclin-E1
15	9606.ENSP00000358155	0.839	Histone cluster 2 H2A family member a4
16	9606.ENSP00000244573	0.831	Histone H1.1
17	9606.ENSP00000212015	0.750	NAD-dependent protein deacetylase sirtuin-1
18	9606.ENSP00000482538	0.745	Histone H2A type 1
19	9606.ENSP00000484841	0.742	Histone H3.1
20	9606.ENSP00000244537	0.741	Histone cluster 1 H4 family member f

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0003682	0.951	chromatin binding
GO:0031490	0.895	chromatin DNA binding
GO:0003723	0.866	RNA binding
GO:0019899	0.531	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0010468	0.982	regulation of gene expression
GO:0071840	0.970	cellular component organization or biogenesis
GO:0031323	0.965	regulation of cellular metabolic process
GO:0016043	0.962	cellular component organization
GO:0080090	0.959	regulation of primary metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0048523	0.936	negative regulation of cellular process
GO:0006325	0.930	chromatin organization
GO:0006355	0.918	regulation of DNA-templated transcription
GO:0000122	0.908	negative regulation of transcription by RNA polymerase II
GO:0071704	0.904	organic substance metabolic process
GO:0044238	0.892	primary metabolic process
GO:0044237	0.880	cellular metabolic process
GO:0006807	0.868	nitrogen compound metabolic process
GO:0043170	0.860	macromolecule metabolic process
GO:0018205	0.753	peptidyl-lysine modification
GO:0032259	0.683	methylation
GO:0043414	0.645	macromolecule methylation
GO:0016570	0.635	histone modification
GO:0048518	0.618	positive regulation of biological process
GO:0018022	0.584	peptidyl-lysine methylation
GO:0034968	0.516	histone lysine methylation
GO:0018023	0.513	peptidyl-lysine trimethylation
GO:0048522	0.441	positive regulation of cellular process
GO:0051568	0.432	histone H3-K4 methylation
GO:0009893	0.355	positive regulation of metabolic process
GO:0032502	0.341	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0000785	0.999	chromatin
GO:0031981	0.984	nuclear lumen
GO:0005654	0.972	nucleoplasm
GO:0032991	0.690	protein-containing complex
GO:0005737	0.677	cytoplasm
GO:0032993	0.316	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]