StarFunc result for job id P16410

User Input

>input (223 residues)
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16410	1.000	1.000	2.061E-40	223	1.000	1.000	P16410.pdb.gz	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
2	AFDB:A0A096MJE4	0.776	0.776	2.016E-31	223	0.753	0.753	A0A096MJE4.pdb.gz	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
3	AFDB:P09793	0.714	0.714	4.094E-31	223	0.744	0.744	P09793.pdb.gz	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
4	AFDB:P10747	0.495	0.501	7.756E-15	220	0.283	0.286	P10747.pdb.gz	CD28_HUMAN T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1
5	AFDB:P31041	0.602	0.614	3.028E-14	218	0.256	0.261	P31041.pdb.gz	CD28_MOUSE T-cell-specific surface glycoprotein CD28 OS=Mus musculus OX=10090 GN=Cd28 PE=1 SV=2
6	AFDB:O14931	0.455	0.494	1.951E-10	201	0.215	0.239	O14931.pdb.gz	NCTR3_HUMAN Natural cytotoxicity triggering receptor 3 OS=Homo sapiens OX=9606 GN=NCR3 PE=1 SV=1
7	AFDB:Q96BF3	0.456	0.367	1.951E-10	282	0.152	0.121	Q96BF3.pdb.gz	TMIG2_HUMAN Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMIGD2 PE=1 SV=2
8	AFDB:Q15116	0.404	0.321	2.144E-9	288	0.175	0.135	Q15116.pdb.gz	PDCD1_HUMAN Programmed cell death protein 1 OS=Homo sapiens OX=9606 GN=PDCD1 PE=1 SV=3
9	AFDB:Q7M729	0.417	0.409	2.391E-9	228	0.179	0.175	Q7M729.pdb.gz	SCN4B_MOUSE Sodium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Scn4b PE=1 SV=1
10	AFDB:Q8IWT1	0.416	0.408	3.140E-9	228	0.175	0.171	Q8IWT1.pdb.gz	SCN4B_HUMAN Sodium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=SCN4B PE=1 SV=1
11	PDB:5ir3A	0.394	0.727	2.199E-8	111	0.126	0.252	5ir3A.pdb.gz
12	PDB:2cd0A	0.384	0.698	2.322E-8	111	0.112	0.225	2cd0A.pdb.gz
13	PDB:6hd8A	0.410	0.212	2.452E-8	461	0.117	0.056	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
14	PDB:6sm1A	0.359	0.658	8.129E-8	111	0.126	0.252	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
15	PDB:1cd0A	0.373	0.669	9.065E-8	111	0.112	0.225	1cd0A.pdb.gz
16	PDB:4y5xB	0.354	0.645	1.327E-7	111	0.108	0.216	4y5xB.pdb.gz
17	PDB:4aizA	0.376	0.716	1.840E-7	107	0.130	0.271	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
18	PDB:2qhrL	0.415	0.424	3.005E-7	218	0.103	0.106	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
19	PDB:1ohqA	0.376	0.625	4.400E-7	120	0.103	0.192	1ohqA.pdb.gz
20	PDB:1jnhA	0.361	0.383	4.647E-7	208	0.094	0.101	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16410	1.17e-167	462	223	1.000	1.000	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
2	Q62859	1.15e-125	356	223	0.758	0.758	Q62859_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=2 SV=1
3	A0A096MJE4	4.50e-124	352	223	0.753	0.753	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
4	P09793	1.36e-122	348	223	0.744	0.744	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
5	G3V7D2	1.17e-69	212	174	0.457	0.586	G3V7D2_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=2
6	P31041	6.23e-15	72.8	218	0.251	0.257	CD28_MOUSE T-cell-specific surface glycoprotein CD28 OS=Mus musculus OX=10090 GN=Cd28 PE=1 SV=2
7	P10747	1.36e-12	66.6	220	0.269	0.273	CD28_HUMAN T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1
8	P31042	1.44e-11	63.5	218	0.247	0.252	CD28_RAT T-cell-specific surface glycoprotein CD28 OS=Rattus norvegicus OX=10116 GN=Cd28 PE=2 SV=1
9	O14931	1.30e-04	43.9	201	0.211	0.234	NCTR3_HUMAN Natural cytotoxicity triggering receptor 3 OS=Homo sapiens OX=9606 GN=NCR3 PE=1 SV=1
10	Q6PIQ7	0.11	35.4	236	0.099	0.093	Q6PIQ7_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
11	P98160	0.15	35.4	4391	0.126	0.006	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
12	A2KUC3	0.17	33.5	121	0.117	0.215	A2KUC3_HUMAN UGa8H (Fragment) OS=Homo sapiens OX=9606 GN=IGHV PE=4 SV=1
13	Q9WVS0	0.23	34.3	200	0.112	0.125	ICOS_MOUSE Inducible T-cell costimulator OS=Mus musculus OX=10090 GN=Icos PE=1 SV=2
14	O60939	0.24	34.3	215	0.108	0.112	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
15	Q4V3D2	0.29	34.3	482	0.072	0.033	ASP36_ARATH Aspartic proteinase 36 OS=Arabidopsis thaliana OX=3702 GN=A36 PE=1 SV=1
16	Q05793	0.31	34.7	3707	0.126	0.008	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
17	A0A8I6A2S5	0.41	34.3	4402	0.099	0.005	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
18	A0A8I6ASH2	0.41	34.3	4387	0.099	0.005	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
19	F1LTJ5	0.43	34.3	2438	0.103	0.009	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
20	P01715	0.44	32.3	115	0.058	0.113	LV301_HUMAN Immunoglobulin lambda variable 3-1 OS=Homo sapiens OX=9606 GN=IGLV3-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	3e+02	12.9	Immunoglobulin I-set domain
2	PF13927 Ig_3	76	15.3	Immunoglobulin domain
3	PF07686 V-set	0.00034	32.1	Immunoglobulin V-set domain
4	PF15910 V-set_2	0.12	23.8	ICOS V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303939

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264246	0.999	T-lymphocyte activation antigen CD80
2	9606.ENSP00000332049	0.999	T-lymphocyte activation antigen CD86
3	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000337825	0.997	Tyrosine-protein kinase Lck
5	9606.ENSP00000339477	0.997	Inducible T-cell co-stimulator ligand
6	9606.ENSP00000365380	0.992	Forkhead box protein P3
7	9606.ENSP00000320084	0.989	CD276 antigen
8	9606.ENSP00000483732	0.989	ICOS ligand
9	9606.ENSP00000376345	0.988	Growth factor receptor-bound protein 2
10	9606.ENSP00000370989	0.987	Programmed cell death 1 ligand 1
11	9606.ENSP00000377036	0.987	Serine/threonine-protein phosphatase 2A activator
12	9606.ENSP00000354782	0.976	T-cell surface glycoprotein CD3 zeta chain
13	9606.ENSP00000380227	0.973	Integrin alpha-4
14	9606.ENSP00000292807	0.967	AP-2 complex subunit mu
15	9606.ENSP00000349252	0.964	Integrin alpha-L
16	9606.ENSP00000361359	0.964	Tumor necrosis factor receptor superfamily member 5
17	9606.ENSP00000339186	0.963	GRB2-related adapter protein 2
18	9606.ENSP00000296585	0.943	Integrin alpha-2
19	9606.ENSP00000380948	0.943	Integrin beta-2
20	9606.ENSP00000379350	0.940	Integrin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.877	molecular transducer activity
GO:0038023	0.838	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002683	0.997	negative regulation of immune system process
GO:1903037	0.997	regulation of leukocyte cell-cell adhesion
GO:0051241	0.996	negative regulation of multicellular organismal process
GO:0048583	0.995	regulation of response to stimulus
GO:0050863	0.995	regulation of T cell activation
GO:0050670	0.995	regulation of lymphocyte proliferation
GO:0008285	0.991	negative regulation of cell population proliferation
GO:0050868	0.989	negative regulation of T cell activation
GO:0050672	0.984	negative regulation of lymphocyte proliferation
GO:0050776	0.982	regulation of immune response
GO:0009987	0.979	cellular process
GO:0050896	0.977	response to stimulus
GO:0048518	0.952	positive regulation of biological process
GO:0007154	0.919	cell communication
GO:0051716	0.881	cellular response to stimulus
GO:0023052	0.877	signaling
GO:0002684	0.852	positive regulation of immune system process
GO:0007165	0.850	signal transduction
GO:0048522	0.840	positive regulation of cellular process
GO:0002376	0.775	immune system process
GO:0048584	0.701	positive regulation of response to stimulus
GO:0007166	0.654	cell surface receptor signaling pathway
GO:0050778	0.631	positive regulation of immune response
GO:0042129	0.559	regulation of T cell proliferation
GO:0050793	0.463	regulation of developmental process
GO:0002764	0.439	immune response-regulating signaling pathway
GO:0002253	0.429	activation of immune response
GO:0045595	0.410	regulation of cell differentiation
GO:0002757	0.402	immune response-activating signaling pathway
GO:0002768	0.401	immune response-regulating cell surface receptor signaling pathway
GO:0006950	0.399	response to stress
GO:0006955	0.398	immune response
GO:2000026	0.394	regulation of multicellular organismal development
GO:0048585	0.356	negative regulation of response to stimulus
GO:0032501	0.352	multicellular organismal process
GO:0002429	0.344	immune response-activating cell surface receptor signaling pathway
GO:1903706	0.328	regulation of hemopoiesis
GO:0042981	0.327	regulation of apoptotic process
GO:0050851	0.312	antigen receptor-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.998	cell surface
GO:0098552	0.997	side of membrane
GO:0012505	0.992	endomembrane system
GO:0009897	0.992	external side of plasma membrane
GO:0005737	0.980	cytoplasm
GO:0043226	0.966	organelle
GO:0043227	0.943	membrane-bounded organelle
GO:0043229	0.936	intracellular organelle
GO:0032991	0.933	protein-containing complex
GO:0043231	0.919	intracellular membrane-bounded organelle
GO:0031982	0.855	vesicle
GO:0097708	0.645	intracellular vesicle
GO:0031410	0.610	cytoplasmic vesicle
GO:0005794	0.470	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]