StarFunc result for job id P16422

User Input

>input (314 residues)
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF
ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL
DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
EIKEMGEMHRELNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5MCA4	0.893	0.823	6.107E-56	342	0.936	0.860	B5MCA4.pdb.gz	B5MCA4_HUMAN Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=1
2	AFDB:O55159	0.868	0.865	2.971E-52	315	0.818	0.816	O55159.pdb.gz	EPCAM_RAT Epithelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Epcam PE=1 SV=1
3	AFDB:P09758	0.713	0.694	1.520E-36	323	0.487	0.474	P09758.pdb.gz	TACD2_HUMAN Tumor-associated calcium signal transducer 2 OS=Homo sapiens OX=9606 GN=TACSTD2 PE=1 SV=3
4	AFDB:Q8BGV3	0.831	0.823	3.955E-36	317	0.497	0.492	Q8BGV3.pdb.gz	TACD2_MOUSE Tumor-associated calcium signal transducer 2 OS=Mus musculus OX=10090 GN=Tacstd2 PE=1 SV=1
5	AFDB:Q6DRJ5	0.688	0.711	5.299E-28	303	0.382	0.396	Q6DRJ5.pdb.gz
6	AFDB:B8JM11	0.641	0.662	5.972E-28	303	0.369	0.383	B8JM11.pdb.gz
7	AFDB:C9JKY3	0.323	0.500	2.017E-16	199	0.325	0.513	C9JKY3.pdb.gz	C9JKY3_HUMAN Epithelial cell adhesion molecule (Fragment) OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=1
8	AFDB:F1RRV3	0.204	0.034	3.036E-4	2692	0.092	0.011	F1RRV3.pdb.gz	THYG_PIG Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=5
9	AFDB:Q63475	0.235	0.084	2.057E-3	1004	0.108	0.034	Q63475.pdb.gz	PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus OX=10116 GN=Ptprn2 PE=1 SV=1
10	AFDB:Q92932	0.188	0.081	4.750E-3	1015	0.080	0.025	Q92932.pdb.gz	PTPR2_HUMAN Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2 PE=1 SV=2
11	PDB:2j0wA	0.153	0.117	6.762E-3	447	0.035	0.025	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.
12	PDB:5mg3F	0.166	0.178	3.014E-2	289	0.051	0.055	5mg3F.pdb.gz
13	PDB:2xmaE	0.181	0.361	5.481E-2	141	0.051	0.113	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
14	PDB:7pliA	0.189	0.138	5.818E-2	457	0.045	0.031	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
15	PDB:3otdA	0.167	0.207	9.387E-2	240	0.045	0.058	3otdA.pdb.gz
16	PDB:3otcA	0.169	0.195	1.266E-1	264	0.045	0.053	3otcA.pdb.gz
17	PDB:6agbH	0.160	0.339	1.266E-1	131	0.029	0.069	6agbH.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.
18	PDB:7nkxZ	0.160	0.283	1.924E-1	156	0.057	0.115	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:2kxoA	0.145	0.366	2.042E-1	89	0.048	0.169	2kxoA.pdb.gz
20	PDB:2gqqC	0.157	0.268	2.443E-1	157	0.048	0.096	2gqqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5MCA4	0.0	605	342	0.933	0.857	B5MCA4_HUMAN Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=1
2	P16422	0.0	652	314	1.000	1.000	EPCAM_HUMAN Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2
3	Q99JW5	0.0	516	315	0.815	0.813	EPCAM_MOUSE Epithelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Epcam PE=1 SV=1
4	O55159	9.43e-174	485	315	0.818	0.816	EPCAM_RAT Epithelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Epcam PE=1 SV=1
5	Q8BGV3	4.88e-88	268	317	0.481	0.476	TACD2_MOUSE Tumor-associated calcium signal transducer 2 OS=Mus musculus OX=10090 GN=Tacstd2 PE=1 SV=1
6	P09758	5.84e-87	265	323	0.475	0.461	TACD2_HUMAN Tumor-associated calcium signal transducer 2 OS=Homo sapiens OX=9606 GN=TACSTD2 PE=1 SV=3
7	C9JKY3	5.60e-69	215	199	0.325	0.513	C9JKY3_HUMAN Epithelial cell adhesion molecule (Fragment) OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=1
8	Q568H0	2.89e-56	186	303	0.366	0.380	Q568H0_DANRE Epithelial cell adhesion molecule precursor OS=Danio rerio OX=7955 GN=zgc:110304 PE=1 SV=1
9	P06882	0.001	43.1	2768	0.092	0.010	THYG_RAT Thyroglobulin OS=Rattus norvegicus OX=10116 GN=Tg PE=1 SV=4
10	A0A193GP06	0.002	42.4	2733	0.086	0.010	A0A193GP06_DANRE Thyroglobulin OS=Danio rerio OX=7955 GN=Tg PE=1 SV=1
11	Q9VCR3	0.002	42.4	629	0.054	0.027	COW_DROME Proteoglycan Cow OS=Drosophila melanogaster OX=7227 GN=Cow PE=1 SV=3
12	O08710	0.003	42.0	2766	0.092	0.010	THYG_MOUSE Thyroglobulin OS=Mus musculus OX=10090 GN=Tg PE=1 SV=3
13	F1RGY5	0.004	41.6	1309	0.064	0.015	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4
14	Q08629	0.006	40.4	439	0.064	0.046	TICN1_HUMAN Testican-1 OS=Homo sapiens OX=9606 GN=SPOCK1 PE=1 SV=1
15	P10247	0.007	40.0	280	0.064	0.071	HG2A_RAT H-2 class II histocompatibility antigen gamma chain OS=Rattus norvegicus OX=10116 GN=Cd74 PE=1 SV=2
16	Q62288	0.007	40.0	442	0.064	0.045	TICN1_MOUSE Testican-1 OS=Mus musculus OX=10090 GN=Spock1 PE=2 SV=2
17	Q9BD54	0.009	39.7	288	0.076	0.083	Q9BD54_CHICK MHC class II-associated invariant chain (Fragment) OS=Gallus gallus OX=9031 GN=CD74 PE=2 SV=2
18	Q6J613	0.010	39.7	286	0.076	0.084	Q6J613_CHICK Invariant chain isoform p41 OS=Gallus gallus OX=9031 GN=Ii PE=1 SV=1
19	P04441	0.012	39.3	279	0.064	0.072	HG2A_MOUSE H-2 class II histocompatibility antigen gamma chain OS=Mus musculus OX=10090 GN=Cd74 PE=1 SV=3
20	E1B279	0.019	38.5	285	0.086	0.095	E1B279_COTJA Invariant chain isoform CIi2-Ii OS=Coturnix japonica OX=93934 GN=Ii2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06143 Baculo_11_kDa	8.1e+02	11.0	Baculovirus 11 kDa family
2	PF05454 DAG1	48	14.8	Dystroglycan (Dystrophin-associated glycoprotein 1)
3	PF18635 EpCAM_N	1.4e-14	65.2	Epithelial cell adhesion molecule N-terminal domain
4	PF14575 EphA2_TM	1.9e+02	14.2	Ephrin type-A receptor 2 transmembrane domain
5	PF01102 Glycophorin_A	2.9e+02	13.1	Glycophorin A
6	PF00086 Thyroglobulin_1	3.2e-10	50.8	Thyroglobulin type-1 repeat
7	PF09534 Trp_oprn_chp	6.6e+02	11.5	Tryptophan-associated transmembrane protein (Trp_oprn_chp)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353475	0.996	Claudin-7
2	9606.ENSP00000344456	0.959	Catenin beta-1
3	9606.ENSP00000386665	0.929	Four and a half LIM domains protein 2
4	9606.ENSP00000261769	0.916	Cadherin-1
5	9606.ENSP00000355124	0.913	Keratin, type I cytoskeletal 19
6	9606.ENSP00000398632	0.897	CD44 antigen
7	9606.ENSP00000426809	0.857	Prominin-1
8	9606.ENSP00000371958	0.848	CD9 antigen
9	9606.ENSP00000483985	0.845	Signal transducer CD24
10	9606.ENSP00000411355	0.835	Receptor-type tyrosine-protein phosphatase C
11	9606.ENSP00000377003	0.825	Tetraspanin-8
12	9606.ENSP00000301244	0.821	Kunitz-type protease inhibitor 2
13	9606.ENSP00000449404	0.816	Keratin, type II cytoskeletal 8
14	9606.ENSP00000373487	0.787	Keratin, type I cytoskeletal 18
15	9606.ENSP00000392330	0.779	B-cell receptor-associated protein 31
16	9606.ENSP00000378577	0.772	Claudin-3
17	9606.ENSP00000386896	0.766	Integrin alpha-6
18	9606.ENSP00000269571	0.753	Receptor tyrosine-protein kinase erbB-2
19	9606.ENSP00000265849	0.740	Mismatch repair endonuclease PMS2
20	9606.ENSP00000405738	0.738	Epithelial splicing regulatory protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.861	cell adhesion molecule binding
GO:0098631	0.846	cell adhesion mediator activity
GO:0044877	0.831	protein-containing complex binding
GO:0045296	0.794	cadherin binding
GO:0098632	0.786	cell-cell adhesion mediator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0032502	0.985	developmental process
GO:0048518	0.982	positive regulation of biological process
GO:0048856	0.934	anatomical structure development
GO:0048522	0.930	positive regulation of cellular process
GO:0048523	0.915	negative regulation of cellular process
GO:0050896	0.908	response to stimulus
GO:0019222	0.902	regulation of metabolic process
GO:0030155	0.894	regulation of cell adhesion
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:2000145	0.858	regulation of cell motility
GO:0042127	0.823	regulation of cell population proliferation
GO:0080090	0.810	regulation of primary metabolic process
GO:0051171	0.810	regulation of nitrogen compound metabolic process
GO:0031323	0.793	regulation of cellular metabolic process
GO:0032501	0.777	multicellular organismal process
GO:0051716	0.776	cellular response to stimulus
GO:0009893	0.676	positive regulation of metabolic process
GO:0010604	0.611	positive regulation of macromolecule metabolic process
GO:0010468	0.579	regulation of gene expression
GO:0031326	0.539	regulation of cellular biosynthetic process
GO:0019219	0.539	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.532	regulation of RNA metabolic process
GO:0010556	0.529	regulation of macromolecule biosynthetic process
GO:0072091	0.515	regulation of stem cell proliferation
GO:0051173	0.509	positive regulation of nitrogen compound metabolic process
GO:0007154	0.495	cell communication
GO:0023052	0.475	signaling
GO:0031325	0.473	positive regulation of cellular metabolic process
GO:1903506	0.465	regulation of nucleic acid-templated transcription
GO:0007275	0.459	multicellular organism development
GO:0006355	0.449	regulation of DNA-templated transcription
GO:0007165	0.442	signal transduction
GO:0010941	0.426	regulation of cell death
GO:0048513	0.306	animal organ development
GO:0042981	0.304	regulation of apoptotic process
GO:2000147	0.303	positive regulation of cell motility
GO:0008284	0.302	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.983	extracellular region
GO:0043227	0.977	membrane-bounded organelle
GO:0030054	0.874	cell junction
GO:0005615	0.862	extracellular space
GO:0043230	0.861	extracellular organelle
GO:0065010	0.845	extracellular membrane-bounded organelle
GO:0070062	0.844	extracellular exosome
GO:0070161	0.793	anchoring junction
GO:0043229	0.775	intracellular organelle
GO:0005911	0.745	cell-cell junction
GO:0043231	0.734	intracellular membrane-bounded organelle
GO:0016328	0.701	lateral plasma membrane
GO:0098590	0.698	plasma membrane region
GO:0005737	0.674	cytoplasm
GO:0045178	0.526	basal part of cell
GO:0043296	0.496	apical junction complex
GO:0009925	0.447	basal plasma membrane
GO:0016323	0.441	basolateral plasma membrane
GO:0009986	0.395	cell surface
GO:0070160	0.350	tight junction
GO:0005923	0.342	bicellular tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]