StarFunc result for job id P16435

User Input

>input (677 residues)
MGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTL
TSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLA
DLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEH
FNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHL
MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWV
VEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYET
KAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPF
IGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQS
HKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVD
YIKKLMTKGRYSLDVWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6j79A	0.680	0.569	0.000	816	0.835	0.692	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
2	AFDB:E1AVU6	0.907	0.909	0.000	676	0.815	0.817	E1AVU6.pdb.gz	E1AVU6_CHICK NADPH--cytochrome P450 reductase OS=Gallus gallus OX=9031 GN=POR PE=2 SV=1
3	AFDB:P00388	0.935	0.934	0.000	678	0.925	0.923	P00388.pdb.gz	NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=3
4	AFDB:Q27597	0.891	0.888	2.952E-99	679	0.566	0.564	Q27597.pdb.gz	NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster OX=7227 GN=Cpr PE=1 SV=2
5	AFDB:Q09590	0.884	0.904	5.540E-87	662	0.461	0.471	Q09590.pdb.gz	Q09590_CAEEL NADPH--cytochrome P450 reductase OS=Caenorhabditis elegans OX=6239 GN=emb-8 PE=1 SV=1
6	AFDB:Q9SB48	0.830	0.813	6.883E-72	692	0.371	0.363	Q9SB48.pdb.gz	NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana OX=3702 GN=ATR1 PE=1 SV=1
7	AFDB:Q0J705	0.805	0.760	2.277E-71	719	0.371	0.349	Q0J705.pdb.gz	NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR2 PE=1 SV=2
8	AFDB:A0A7T9QPQ1	0.820	0.787	7.117E-71	706	0.368	0.353	A0A7T9QPQ1.pdb.gz	C719A_PIPNI Piperic acid synthase CYP719A37 OS=Piper nigrum OX=13216 GN=CYP719A37 PE=1 SV=1
9	AFDB:C5YJG8	0.816	0.784	8.939E-71	706	0.363	0.348	C5YJG8.pdb.gz	NCPR_SORBI NADPH--cytochrome P450 reductase OS=Sorghum bicolor OX=4558 GN=CPR PE=1 SV=1
10	AFDB:Q653S9	0.826	0.785	2.639E-70	714	0.374	0.354	Q653S9.pdb.gz	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
11	AFDB:Q7X7K8	0.814	0.793	1.301E-69	695	0.374	0.364	Q7X7K8.pdb.gz	NCPR1_ORYSJ NADPH--cytochrome P450 reductase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR1 PE=1 SV=2
12	PDB:5gxuA	0.647	0.779	9.469E-63	552	0.347	0.426	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
13	PDB:2bf4A	0.827	0.867	1.869E-57	645	0.313	0.329	2bf4A.pdb.gz	A Second Fmn-Binding Site in Yeast Nadph-Cytochrome P450 Reductase Suggests a Mechanism of Electron Transfer by Diflavin Reductases.
14	PDB:7suzA	0.550	0.941	4.823E-44	389	0.238	0.414	7suzA.pdb.gz	Functional and structural insight into the flexibility of cytochrome P450 reductases from Sorghum bicolor and its implications for lignin composition.
15	PDB:3lvbA	0.360	0.754	4.784E-17	311	0.118	0.257	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues
16	PDB:4oxxA	0.206	0.835	2.242E-9	153	0.069	0.307	4oxxA.pdb.gz	Crystal structure of cindoxin, the P450cin redox partner.
17	PDB:2m6sA	0.199	0.823	8.802E-9	149	0.053	0.242	2m6sA.pdb.gz	1H, 13C and 15N resonance assignments of the apo and holo states of flavodoxin YqcA from Escherichia coli.
18	PDB:1gvhA	0.265	0.427	1.356E-7	396	0.068	0.116	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
19	PDB:1fdrA	0.211	0.528	7.933E-7	244	0.058	0.160	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
20	PDB:7xk3F	0.296	0.465	1.572E-6	408	0.075	0.125	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1AVU6	0.0	1189	676	0.817	0.818	E1AVU6_CHICK NADPH--cytochrome P450 reductase OS=Gallus gallus OX=9031 GN=POR PE=2 SV=1
2	P00388	0.0	1330	678	0.926	0.925	NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=3
3	P16435	0.0	1417	677	1.000	1.000	NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2
4	P37040	0.0	1323	678	0.922	0.920	NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus OX=10090 GN=Por PE=1 SV=2
5	Q09590	0.0	657	662	0.474	0.485	Q09590_CAEEL NADPH--cytochrome P450 reductase OS=Caenorhabditis elegans OX=6239 GN=emb-8 PE=1 SV=1
6	Q27597	0.0	820	679	0.561	0.560	NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster OX=7227 GN=Cpr PE=1 SV=2
7	Q9SB48	3.74e-153	461	692	0.362	0.354	NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana OX=3702 GN=ATR1 PE=1 SV=1
8	Q653S9	3.79e-152	459	714	0.363	0.345	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
9	Q0J705	5.09e-149	451	719	0.356	0.335	NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR2 PE=1 SV=2
10	Q7X7K8	4.51e-146	443	695	0.360	0.351	NCPR1_ORYSJ NADPH--cytochrome P450 reductase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR1 PE=1 SV=2
11	C5YJG8	1.32e-145	442	706	0.363	0.348	NCPR_SORBI NADPH--cytochrome P450 reductase OS=Sorghum bicolor OX=4558 GN=CPR PE=1 SV=1
12	Q9SUM3	3.08e-145	441	711	0.381	0.363	NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
13	Q384I1	6.49e-143	432	635	0.360	0.384	Q384I1_TRYB2 NADPH--cytochrome P450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0170 PE=4 SV=1
14	A0A2U1LIM9	4.38e-142	433	704	0.350	0.337	NCPR1_ARTAN NADPH--cytochrome P450 reductase 1 OS=Artemisia annua OX=35608 GN=CPR1 PE=1 SV=2
15	Q00141	3.69e-140	427	694	0.372	0.363	NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger OX=5061 GN=cprA PE=1 SV=2
16	Q7Z270	2.51e-139	423	635	0.355	0.378	Q7Z270_TRYBB p450 reductase OS=Trypanosoma brucei brucei OX=5702 PE=4 SV=1
17	A0A7T9QPQ1	9.55e-139	424	706	0.381	0.365	C719A_PIPNI Piperic acid synthase CYP719A37 OS=Piper nigrum OX=13216 GN=CYP719A37 PE=1 SV=1
18	Q384R3	3.64e-137	418	631	0.347	0.372	Q384R3_TRYB2 NADPH--cytochrome p450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5420 PE=4 SV=1
19	P36587	4.93e-124	385	678	0.369	0.369	NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr1 PE=2 SV=1
20	A0A1D8PLR7	1.02e-121	379	680	0.343	0.341	A0A1D8PLR7_CANAL NADPH--cytochrome P450 reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NCP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15958 DUF4761	3e+02	13.0	Domain of unknown function (DUF4761)
2	PF00667 FAD_binding_1	1.3e-80	281.7	FAD binding domain
3	PF00258 Flavodoxin_1	1.1e-36	137.7	Flavodoxin
4	PF00175 NAD_binding_1	1.4e-13	62.8	Oxidoreductase NAD-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419970

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341625	0.992	Cytochrome b5
2	9606.ENSP00000358903	0.990	Steroid 17-alpha-hydroxylase/17,20 lyase
3	9606.ENSP00000440689	0.988	Cytochrome P450 2E1
4	9606.ENSP00000337915	0.972	Cytochrome P450 3A4
5	9606.ENSP00000003100	0.958	Lanosterol 14-alpha demethylase
6	9606.ENSP00000360372	0.958	Cytochrome P450 2C19
7	9606.ENSP00000289081	0.939	Fanconi anemia group C protein
8	9606.ENSP00000379683	0.926	Aromatase
9	9606.ENSP00000378972	0.925	Sulfotransferase 1A1
10	9606.ENSP00000324648	0.920	Cytochrome P450 2B6
11	9606.ENSP00000378992	0.918	Sulfotransferase 1A2
12	9606.ENSP00000360266	0.912	Transcription factor AP-1
13	9606.ENSP00000380252	0.911	Nuclear factor erythroid 2-related factor 2
14	9606.ENSP00000216117	0.908	Heme oxygenase 1
15	9606.ENSP00000387683	0.907	UDP-glucuronosyltransferase 2B11
16	9606.ENSP00000370639	0.902	Acetylserotonin O-methyltransferase
17	9606.ENSP00000387699	0.901	Cyclic AMP-responsive element-binding protein 1
18	9606.ENSP00000292079	0.900	Sodium/potassium-transporting ATPase subunit gamma
19	9606.ENSP00000306245	0.900	Proto-oncogene c-Fos
20	9606.ENSP00000342007	0.879	Cytochrome P450 1A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003958	0.999	NADPH-hemoprotein reductase activity
GO:0005515	0.997	protein binding
GO:0097159	0.888	organic cyclic compound binding
GO:1901363	0.877	heterocyclic compound binding
GO:0036094	0.795	small molecule binding
GO:0097367	0.640	carbohydrate derivative binding
GO:0043168	0.637	anion binding
GO:0032553	0.627	ribonucleotide binding
GO:0050660	0.494	flavin adenine dinucleotide binding
GO:0016705	0.403	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0030554	0.355	adenyl nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.997	metabolic process
GO:0071704	0.983	organic substance metabolic process
GO:0044237	0.968	cellular metabolic process
GO:0044238	0.943	primary metabolic process
GO:0065007	0.601	biological regulation
GO:0050896	0.582	response to stimulus
GO:0006807	0.501	nitrogen compound metabolic process
GO:0051716	0.405	cellular response to stimulus
GO:1901564	0.382	organonitrogen compound metabolic process
GO:0042221	0.366	response to chemical
GO:0070887	0.347	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031090	0.979	organelle membrane
GO:0005789	0.962	endoplasmic reticulum membrane
GO:0005739	0.310	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24040	0.999	NADPH + 2 oxidized [cytochrome P450] = H(+) + NADP(+) + 2 reduced [cytochrome P450]
EC:1.6.2.4	0.999	NADPH--hemoprotein reductase.
EC:1.14.-.-	0.403	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]