StarFunc result for job id P16442

User Input

>input (354 residues)
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
LQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
WQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0B1U2	0.849	0.849	6.626E-76	354	0.989	0.989	B0B1U2.pdb.gz	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
2	AFDB:Q9ET32	0.844	0.859	3.970E-63	348	0.734	0.747	Q9ET32.pdb.gz	BGAT1_RAT Histo-blood group ABO system transferase 1 OS=Rattus norvegicus OX=10116 GN=Abo PE=1 SV=1
3	PDB:4y63A	0.796	0.999	7.367E-61	282	0.791	0.993	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
4	AFDB:Q8CFC4	0.826	0.875	1.598E-59	334	0.684	0.725	Q8CFC4.pdb.gz	BGAT2_RAT Histo-blood group ABO system transferase 2 OS=Rattus norvegicus OX=10116 GN=Abo2 PE=1 SV=1
5	AFDB:P38649	0.823	0.877	2.622E-59	332	0.689	0.735	P38649.pdb.gz	BGAT_MOUSE Histo-blood group ABO system transferase OS=Mus musculus OX=10090 GN=Abo PE=1 SV=2
6	AFDB:Q8VI38	0.821	0.837	1.072E-45	347	0.432	0.441	Q8VI38.pdb.gz	GBGT1_MOUSE Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Gbgt1 PE=1 SV=2
7	AFDB:Q95158	0.795	0.810	5.365E-45	347	0.421	0.429	Q95158.pdb.gz	GBGT1_CANLF Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=GBGT1 PE=1 SV=1
8	AFDB:Q8N5D6	0.818	0.835	7.312E-45	347	0.429	0.438	Q8N5D6.pdb.gz	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
9	AFDB:Q3L7M0	0.766	0.732	6.120E-40	371	0.415	0.396	Q3L7M0.pdb.gz	GGTA1_RAT N-acetyllactosaminide alpha-1,3-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=Ggta1 PE=1 SV=2
10	AFDB:A0A4Z3	0.756	0.789	2.677E-38	339	0.353	0.369	A0A4Z3.pdb.gz	A3LT2_RAT Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1
11	AFDB:Q3V1N9	0.768	0.736	4.394E-38	370	0.398	0.381	Q3V1N9.pdb.gz	A3LT2_MOUSE Alpha-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=A3galt2 PE=2 SV=1
12	PDB:1ll0B	0.365	0.464	8.123E-7	267	0.073	0.097	1ll0B.pdb.gz
13	PDB:8cvzI	0.367	0.464	8.123E-7	267	0.059	0.079	8cvzI.pdb.gz
14	PDB:7jhiC	0.336	0.356	1.690E-5	331	0.068	0.073	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
15	PDB:6fxrA	0.344	0.189	7.023E-5	700	0.082	0.041	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
16	PDB:7f66J	0.294	0.194	3.979E-4	591	0.073	0.044	7f66J.pdb.gz
17	PDB:2gamC	0.313	0.300	6.138E-4	374	0.079	0.075	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
18	PDB:4d0tA	0.375	0.279	7.864E-4	496	0.085	0.060	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
19	PDB:6b5eB	0.285	0.338	8.367E-4	286	0.076	0.094	6b5eB.pdb.gz	The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.
20	PDB:4hg6A	0.331	0.173	9.470E-4	747	0.105	0.050	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0B1U2	0.0	728	354	0.989	0.989	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
2	P16442	0.0	735	354	1.000	1.000	BGAT_HUMAN Histo-blood group ABO system transferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=2
3	P38649	0.0	505	332	0.703	0.750	BGAT_MOUSE Histo-blood group ABO system transferase OS=Mus musculus OX=10090 GN=Abo PE=1 SV=2
4	Q9ET32	0.0	538	348	0.729	0.741	BGAT1_RAT Histo-blood group ABO system transferase 1 OS=Rattus norvegicus OX=10116 GN=Abo PE=1 SV=1
5	Q8CFC4	1.15e-179	503	334	0.701	0.743	BGAT2_RAT Histo-blood group ABO system transferase 2 OS=Rattus norvegicus OX=10116 GN=Abo2 PE=1 SV=1
6	Q8VI38	6.97e-103	308	347	0.424	0.432	GBGT1_MOUSE Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Gbgt1 PE=1 SV=2
7	Q95158	4.75e-98	296	347	0.404	0.412	GBGT1_CANLF Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=GBGT1 PE=1 SV=1
8	Q8N5D6	2.56e-97	294	347	0.404	0.412	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
9	Q3L7M0	8.21e-86	265	371	0.407	0.388	GGTA1_RAT N-acetyllactosaminide alpha-1,3-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=Ggta1 PE=1 SV=2
10	Q3V1N9	1.01e-76	242	370	0.410	0.392	A3LT2_MOUSE Alpha-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=A3galt2 PE=2 SV=1
11	A0A4Z3	9.32e-76	239	339	0.356	0.372	A3LT2_RAT Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1
12	Q10059	0.66	34.7	1841	0.051	0.010	CDC12_SCHPO Cell division control protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc12 PE=1 SV=1
13	Q57X92	0.79	34.3	539	0.093	0.061	Q57X92_TRYB2 Transmembrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.380 PE=4 SV=1
14	G5ECD0	3.8	32.0	495	0.088	0.063	G5ECD0_CAEEL CYtochrome P450 family OS=Caenorhabditis elegans OX=6239 GN=cyp-35c1 PE=1 SV=1
15	Q84W41	6.4	31.2	903	0.054	0.021	GLR36_ARATH Glutamate receptor 3.6 OS=Arabidopsis thaliana OX=3702 GN=GLR3.6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03414 Glyco_transf_6	3.5e-164	556.7	Glycosyltransferase family 6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000036816

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000054359	0.990	Galactoside 2-alpha-L-fucosyltransferase 2
2	9598.ENSPTRP00000019304	0.989	Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Gal-beta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway.
3	9598.ENSPTRP00000054902	0.988	May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of sialyl Lewis X and Lewis X/SSEA-1 antigens. It may be involved in blood group Lewis determination (By similarity). Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links
4	9598.ENSPTRP00000049078	0.945	May catalyze alpha-1,3 glycosidic linkages involved in the expression of VIM-2, Lewis X/SSEA-1 and sialyl Lewis X antigens.
5	9598.ENSPTRP00000049080	0.945	Enzyme involved in the biosynthesis of the E-Selectin ligand, sialyl-Lewis X. Catalyzes the transfer of fucose from GDP-beta-fucose to alpha-2,3 sialylated substrates (By similarity)
6	9598.ENSPTRP00000031484	0.915	Alpha-(1,3)-fucosyltransferase 9
7	9598.ENSPTRP00000047698	0.915	Alpha-(1,3)-fucosyltransferase 4
8	9598.ENSPTRP00000005977	0.631	Cysteine and glycine-rich protein 3 (cardiac LIM protein)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008194	1.000	UDP-glycosyltransferase activity
GO:0008378	1.000	galactosyltransferase activity
GO:0030145	0.995	manganese ion binding
GO:0003823	0.994	antigen binding
GO:0000166	0.994	nucleotide binding
GO:0035250	0.876	UDP-galactosyltransferase activity
GO:0008376	0.812	acetylgalactosaminyltransferase activity
GO:0005515	0.749	protein binding
GO:0140103	0.625	catalytic activity, acting on a glycoprotein
GO:0004380	0.445	glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0005975	0.950	carbohydrate metabolic process
GO:0009987	0.806	cellular process
GO:0009058	0.388	biosynthetic process
GO:0044237	0.388	cellular metabolic process
GO:0009312	0.375	oligosaccharide biosynthetic process
GO:0006807	0.344	nitrogen compound metabolic process
GO:0050794	0.338	regulation of cellular process
GO:1901564	0.319	organonitrogen compound metabolic process
GO:0044249	0.309	cellular biosynthetic process
GO:1901135	0.301	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	1.000	Golgi apparatus
GO:0031090	0.987	organelle membrane
GO:0000139	0.979	Golgi membrane
GO:0005576	0.968	extracellular region
GO:0031982	0.550	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:19021	0.445	an alpha-L-fucosyl-(1->2)-beta-D-galactosyl derivative + UDP-N-acetyl-alpha-D-galactosamine = an N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative + H(+) + UDP
EC:2.4.1.40	0.445	glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.

[back to server]