StarFunc result for job id P16455

User Input

>input (207 residues)
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DEE8	0.877	0.766	1.066E-36	238	1.000	0.870	B4DEE8.pdb.gz	B4DEE8_HUMAN Methylated-DNA--protein-cysteine methyltransferase OS=Homo sapiens OX=9606 GN=MGMT PE=1 SV=1
2	PDB:1eh6A	0.794	0.976	2.105E-29	168	0.807	0.994	1eh6A.pdb.gz	Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
3	AFDB:P26187	0.800	0.785	1.476E-27	211	0.700	0.687	P26187.pdb.gz	MGMT_MOUSE Methylated-DNA--protein-cysteine methyltransferase OS=Mus musculus OX=10090 GN=Mgmt PE=1 SV=3
4	PDB:4bhbA	0.597	0.738	3.396E-11	165	0.275	0.345	4bhbA.pdb.gz
5	AFDB:P0AFH0	0.626	0.748	6.232E-11	171	0.261	0.316	P0AFH0.pdb.gz	OGT_ECOLI Methylated-DNA--protein-cysteine methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ogt PE=1 SV=1
6	AFDB:P9WJW5	0.600	0.741	6.996E-11	165	0.275	0.345	P9WJW5.pdb.gz	OGT_MYCTU Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ogt PE=1 SV=1
7	AFDB:P06134	0.535	0.323	2.497E-10	354	0.251	0.147	P06134.pdb.gz	ADA_ECOLI Bifunctional transcriptional activator/DNA repair enzyme Ada OS=Escherichia coli (strain K12) OX=83333 GN=ada PE=1 SV=2
8	AFDB:Q9U1Y0	0.619	0.722	6.365E-9	175	0.227	0.269	Q9U1Y0.pdb.gz	Q9U1Y0_CAEEL Methylated-DNA--protein-cysteine methyltransferase OS=Caenorhabditis elegans OX=6239 GN=agt-1 PE=1 SV=2
9	AFDB:O76339	0.551	0.586	1.802E-8	194	0.203	0.216	O76339.pdb.gz	O76339_DROME Methylated-DNA--protein-cysteine methyltransferase OS=Drosophila melanogaster OX=7227 GN=agt PE=2 SV=1
10	AFDB:P26188	0.619	0.677	2.407E-8	188	0.213	0.234	P26188.pdb.gz	MGMT_YEAST Methylated-DNA--protein-cysteine methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGT1 PE=1 SV=3
11	AFDB:P0AFP2	0.362	0.565	5.913E-5	129	0.140	0.225	P0AFP2.pdb.gz	ATL_ECOLI DNA base-flipping protein OS=Escherichia coli (strain K12) OX=83333 GN=atl PE=1 SV=1
12	AFDB:Q38FP0	0.521	0.504	3.762E-4	215	0.193	0.186	Q38FP0.pdb.gz	Q38FP0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1490 PE=4 SV=1
13	PDB:4enjA	0.348	0.638	7.832E-3	108	0.111	0.213	4enjA.pdb.gz	Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
14	PDB:4ev0D	0.163	0.158	7.549E-1	214	0.097	0.093	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
15	PDB:2z5eA	0.136	0.187	8.979E-1	122	0.106	0.180	2z5eA.pdb.gz
16	PDB:7awtG	0.122	0.041	1.008	907	0.126	0.029	7awtG.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
17	PDB:3cdiA	0.136	0.065	1.904	516	0.092	0.037	3cdiA.pdb.gz
18	PDB:3r07C	0.110	0.225	2.400	88	0.014	0.034	3r07C.pdb.gz
19	PDB:7acoB	0.171	0.194	2.543	180	0.039	0.044	7acoB.pdb.gz
20	PDB:2fe3B	0.185	0.258	2.854	143	0.058	0.084	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16455	4.41e-151	419	207	1.000	1.000	MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase OS=Homo sapiens OX=9606 GN=MGMT PE=1 SV=1
2	B4DEE8	9.68e-151	419	238	1.000	0.870	B4DEE8_HUMAN Methylated-DNA--protein-cysteine methyltransferase OS=Homo sapiens OX=9606 GN=MGMT PE=1 SV=1
3	P26187	1.60e-97	283	211	0.705	0.692	MGMT_MOUSE Methylated-DNA--protein-cysteine methyltransferase OS=Mus musculus OX=10090 GN=Mgmt PE=1 SV=3
4	P24528	3.56e-95	278	209	0.696	0.689	MGMT_RAT Methylated-DNA--protein-cysteine methyltransferase OS=Rattus norvegicus OX=10116 GN=Mgmt PE=1 SV=3
5	P9WJW5	9.01e-21	86.7	165	0.295	0.370	OGT_MYCTU Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ogt PE=1 SV=1
6	P0AFH0	1.31e-20	86.7	171	0.203	0.246	OGT_ECOLI Methylated-DNA--protein-cysteine methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ogt PE=1 SV=1
7	P06134	1.26e-15	76.3	354	0.261	0.153	ADA_ECOLI Bifunctional transcriptional activator/DNA repair enzyme Ada OS=Escherichia coli (strain K12) OX=83333 GN=ada PE=1 SV=2
8	Q2HQK2	5.21e-11	60.1	133	0.169	0.263	Q2HQK2_CAEEL Methylated-DNA--protein-cysteine methyltransferase OS=Caenorhabditis elegans OX=6239 GN=agt-1 PE=1 SV=1
9	Q9U1Y0	1.68e-10	59.7	175	0.169	0.200	Q9U1Y0_CAEEL Methylated-DNA--protein-cysteine methyltransferase OS=Caenorhabditis elegans OX=6239 GN=agt-1 PE=1 SV=2
10	P26188	2.02e-10	59.7	188	0.155	0.170	MGMT_YEAST Methylated-DNA--protein-cysteine methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGT1 PE=1 SV=3
11	O76339	6.95e-09	55.5	194	0.174	0.186	O76339_DROME Methylated-DNA--protein-cysteine methyltransferase OS=Drosophila melanogaster OX=7227 GN=agt PE=2 SV=1
12	P0AFP2	2.30e-07	50.1	129	0.135	0.217	ATL_ECOLI DNA base-flipping protein OS=Escherichia coli (strain K12) OX=83333 GN=atl PE=1 SV=1
13	Q9UTN9	2.66e-04	41.2	108	0.121	0.231	ATL1_SCHPO Alkyltransferase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atl1 PE=1 SV=1
14	Q6L285	1.5	32.0	493	0.077	0.032	GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3) OX=1122961 GN=PTO0332 PE=1 SV=1
15	Q9GYQ9	2.5	31.6	796	0.106	0.028	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
16	P52016	3.4	30.8	447	0.097	0.045	CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 OS=Caenorhabditis elegans OX=6239 GN=cyn-8 PE=2 SV=2
17	D3ZZQ1	7.8	30.0	2944	0.082	0.006	D3ZZQ1_RAT Assembly factor for spindle microtubules OS=Rattus norvegicus OX=10116 GN=Aspm PE=4 SV=3
18	Q96BY7	8.0	30.0	2078	0.121	0.012	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
19	Q5SSE9	9.1	29.6	5034	0.155	0.006	ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus OX=10090 GN=Abca13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01035 DNA_binding_1	7.2e-25	98.2	6-O-methylguanine DNA methyltransferase, DNA binding domain
2	PF02870 Methyltransf_1N	9.2e-21	85.8	6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.914	DNA mismatch repair protein Mlh1
2	9606.ENSP00000390265	0.897	Isocitrate dehydrogenase 1, cytosolic
3	9606.ENSP00000349547	0.831	Ras association domain-containing protein 1
4	9606.ENSP00000306561	0.821	N-glycosylase/DNA lyase
5	9606.ENSP00000233146	0.818	DNA mismatch repair protein Msh2
6	9606.ENSP00000234420	0.810	DNA mismatch repair protein Msh6
7	9606.ENSP00000386135	0.806	Death-associated protein kinase 1
8	9606.ENSP00000418915	0.805	Cyclin-dependent kinase inhibitor 2A
9	9606.ENSP00000216489	0.787	Nucleic acid dioxygenase ALKBH1
10	9606.ENSP00000219431	0.781	DNA-3-methyladenine glycosylase
11	9606.ENSP00000269305	0.761	Cellular tumor antigen p53
12	9606.ENSP00000384290	0.747	WD repeat-containing protein 60
13	9606.ENSP00000331897	0.746	Isocitrate dehydrogenase [NADP], mitochondrial
14	9606.ENSP00000381607	0.744	Glutathione S-transferase P
15	9606.ENSP00000216714	0.724	DNA-(apurinic or apyrimidinic site) lyase
16	9606.ENSP00000275493	0.709	Epidermal growth factor receptor
17	9606.ENSP00000013807	0.693	DNA excision repair protein ERCC-1
18	9606.ENSP00000362441	0.690	Transcriptional regulator ATRX
19	9606.ENSP00000361021	0.687	Phosphatase and tensin homolog
20	9606.ENSP00000364270	0.682	DNA repair protein complementing XP-A cells

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008168	1.000	methyltransferase activity
GO:0003677	1.000	DNA binding
GO:0140097	0.999	catalytic activity, acting on DNA
GO:0009008	0.900	DNA-methyltransferase activity
GO:0005515	0.884	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008152	0.995	metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0048518	0.984	positive regulation of biological process
GO:0019219	0.984	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.983	primary metabolic process
GO:0048583	0.977	regulation of response to stimulus
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0006807	0.963	nitrogen compound metabolic process
GO:0051052	0.956	regulation of DNA metabolic process
GO:0048522	0.952	positive regulation of cellular process
GO:2001020	0.933	regulation of response to DNA damage stimulus
GO:0043170	0.930	macromolecule metabolic process
GO:1901360	0.923	organic cyclic compound metabolic process
GO:0046483	0.923	heterocycle metabolic process
GO:0006725	0.923	cellular aromatic compound metabolic process
GO:0006259	0.899	DNA metabolic process
GO:0009893	0.887	positive regulation of metabolic process
GO:0051173	0.859	positive regulation of nitrogen compound metabolic process
GO:0031325	0.854	positive regulation of cellular metabolic process
GO:0010604	0.850	positive regulation of macromolecule metabolic process
GO:0006282	0.835	regulation of DNA repair
GO:0048519	0.831	negative regulation of biological process
GO:0048584	0.798	positive regulation of response to stimulus
GO:0050896	0.791	response to stimulus
GO:0051716	0.773	cellular response to stimulus
GO:0010941	0.737	regulation of cell death
GO:0033554	0.732	cellular response to stress
GO:0045935	0.710	positive regulation of nucleobase-containing compound metabolic process
GO:2001022	0.705	positive regulation of response to DNA damage stimulus
GO:0048523	0.698	negative regulation of cellular process
GO:0006974	0.658	cellular response to DNA damage stimulus
GO:0006281	0.620	DNA repair
GO:0051054	0.556	positive regulation of DNA metabolic process
GO:0043412	0.413	macromolecule modification
GO:0045739	0.367	positive regulation of DNA repair
GO:0060548	0.357	negative regulation of cell death
GO:2000779	0.311	regulation of double-strand break repair
GO:0043067	0.306	regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.975	membrane
GO:0005737	0.349	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]