StarFunc result for job id P16471

User Input

>input (622 residues)
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16471	0.999	0.999	3.413E-100	622	1.000	1.000	P16471.pdb.gz	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
2	AFDB:Q28172	0.437	0.464	4.162E-66	581	0.646	0.692	Q28172.pdb.gz	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
3	AFDB:Q9DE08	0.384	0.375	2.802E-47	638	0.387	0.378	Q9DE08.pdb.gz	Q9DE08_ONCMY Prolactin receptor OS=Oncorhynchus mykiss OX=8022 GN=PRLR PE=2 SV=1
4	AFDB:Q5MKL1	0.303	0.317	2.451E-28	594	0.252	0.264	Q5MKL1.pdb.gz	Q5MKL1_ONCMY Growth hormone receptor OS=Oncorhynchus mykiss OX=8022 GN=GHR2b PE=2 SV=1
5	AFDB:P19941	0.300	0.293	3.536E-28	638	0.225	0.219	P19941.pdb.gz	GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus OX=9986 GN=GHR PE=1 SV=1
6	AFDB:P19756	0.295	0.288	4.846E-27	638	0.233	0.227	P19756.pdb.gz	GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 GN=GHR PE=1 SV=1
7	AFDB:F1MQ39	0.287	0.282	5.107E-27	634	0.249	0.244	F1MQ39.pdb.gz	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
8	AFDB:P16310	0.303	0.296	5.107E-27	638	0.230	0.224	P16310.pdb.gz	GHR_RAT Growth hormone receptor OS=Rattus norvegicus OX=10116 GN=Ghr PE=1 SV=1
9	AFDB:A0A087X0H5	0.290	0.281	1.992E-26	645	0.225	0.217	A0A087X0H5.pdb.gz	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
10	PDB:7u7nC	0.272	0.782	4.479E-14	200	0.085	0.265	7u7nC.pdb.gz
11	AFDB:Q92859	0.168	0.079	4.924E-14	1461	0.159	0.068	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
12	PDB:7z0lB	0.253	0.408	6.155E-11	370	0.071	0.119	7z0lB.pdb.gz
13	PDB:5mj3A	0.220	0.418	1.581E-9	302	0.053	0.109	5mj3A.pdb.gz
14	PDB:6pxvA	0.157	0.123	8.036E-7	823	0.047	0.035	6pxvA.pdb.gz
15	PDB:8eyyA	0.146	0.121	1.957E-6	775	0.050	0.040	8eyyA.pdb.gz
16	PDB:6pyhD	0.142	0.114	2.543E-6	798	0.050	0.039	6pyhD.pdb.gz
17	PDB:8dtlA	0.148	0.129	2.823E-6	741	0.051	0.043	8dtlA.pdb.gz
18	PDB:3besR	0.189	0.378	8.478E-6	250	0.045	0.112	3besR.pdb.gz
19	PDB:5oj2B	0.173	0.159	1.290E-4	692	0.043	0.039	5oj2B.pdb.gz
20	PDB:7bwaA	0.138	0.130	2.982E-4	674	0.058	0.053	7bwaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05710	0.0	850	610	0.678	0.692	PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 GN=Prlr PE=1 SV=2
2	P16471	0.0	1294	622	1.000	1.000	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
3	Q04594	0.0	612	831	0.494	0.369	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
4	Q08501	0.0	833	608	0.674	0.689	PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=10090 GN=Prlr PE=1 SV=1
5	Q28172	0.0	806	581	0.648	0.694	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
6	Q2PBN9	0.0	800	581	0.648	0.694	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
7	Q90374	0.0	617	830	0.497	0.372	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1
8	F1N4H8	7.07e-156	451	296	0.341	0.716	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2
9	Q9DE08	4.16e-121	375	638	0.367	0.357	Q9DE08_ONCMY Prolactin receptor OS=Oncorhynchus mykiss OX=8022 GN=PRLR PE=2 SV=1
10	A0A087X0H5	1.79e-39	155	645	0.185	0.178	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
11	P10912	1.81e-39	155	638	0.185	0.180	GHR_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
12	P19941	2.46e-39	155	638	0.183	0.179	GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus OX=9986 GN=GHR PE=1 SV=1
13	F1MQ39	1.79e-38	152	634	0.182	0.178	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
14	O46600	1.93e-38	152	634	0.182	0.178	GHR_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=2 SV=2
15	P16310	2.41e-38	152	638	0.190	0.185	GHR_RAT Growth hormone receptor OS=Rattus norvegicus OX=10116 GN=Ghr PE=1 SV=1
16	Q3Y4E0	1.41e-37	149	590	0.177	0.186	Q3Y4E0_SALSA Growth hormone receptor isoform 2 OS=Salmo salar OX=8030 GN=LOC100136463 PE=2 SV=1
17	Q2P9V4	2.49e-37	149	634	0.180	0.177	Q2P9V4_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
18	P19756	5.01e-37	148	638	0.180	0.176	GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 GN=GHR PE=1 SV=1
19	Q5MKL1	7.27e-37	147	594	0.178	0.187	Q5MKL1_ONCMY Growth hormone receptor OS=Oncorhynchus mykiss OX=8022 GN=GHR2b PE=2 SV=1
20	P16882	7.35e-37	148	650	0.225	0.215	GHR_MOUSE Growth hormone receptor OS=Mus musculus OX=10090 GN=Ghr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	7.7e-19	79.2	Erythropoietin receptor, ligand binding
2	PF00041 fn3	0.00022	32.9	Fibronectin type III domain
3	PF12772 GHBP	92	13.8	Growth hormone receptor binding
4	PF09240 IL6Ra-bind	0.038	25.8	Interleukin-6 receptor alpha chain, binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302150	0.999	Prolactin
2	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
3	9606.ENSP00000341208	0.988	Signal transducer and activator of transcription 5A
4	9606.ENSP00000312673	0.984	Somatotropin
5	9606.ENSP00000376623	0.975	Chorionic somatomammotropin hormone 2
6	9606.ENSP00000293328	0.957	Signal transducer and activator of transcription 5B
7	9606.ENSP00000342235	0.926	Receptor tyrosine-protein kinase erbB-4
8	9606.ENSP00000316416	0.925	Chorionic somatomammotropin hormone 1
9	9606.ENSP00000409346	0.909	Cytokine-inducible SH2-containing protein
10	9606.ENSP00000230990	0.908	Proheparin-binding EGF-like growth factor
11	9606.ENSP00000343204	0.871	Tyrosine-protein kinase JAK1
12	9606.ENSP00000391676	0.863	Tyrosine-protein kinase JAK3
13	9606.ENSP00000304895	0.843	Insulin receptor substrate 1
14	9606.ENSP00000333157	0.834	Growth hormone 1 isoform 5
15	9606.ENSP00000340944	0.811	Tyrosine-protein phosphatase non-receptor type 11
16	9606.ENSP00000264657	0.810	Signal transducer and activator of transcription 3
17	9606.ENSP00000354394	0.799	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000359206	0.784	F-box/WD repeat-containing protein 1A
19	9606.ENSP00000252723	0.782	Erythropoietin
20	9606.ENSP00000481249	0.772	Suppressor of cytokine signaling 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0017046	0.993	peptide hormone binding
GO:0008289	0.904	lipid binding
GO:0004925	0.821	prolactin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050896	0.997	response to stimulus
GO:0009987	0.993	cellular process
GO:0009893	0.989	positive regulation of metabolic process
GO:0048522	0.985	positive regulation of cellular process
GO:0051716	0.980	cellular response to stimulus
GO:0001934	0.980	positive regulation of protein phosphorylation
GO:0007165	0.929	signal transduction
GO:0007166	0.910	cell surface receptor signaling pathway
GO:0032501	0.905	multicellular organismal process
GO:0048583	0.848	regulation of response to stimulus
GO:0048856	0.846	anatomical structure development
GO:0023051	0.830	regulation of signaling
GO:0010646	0.830	regulation of cell communication
GO:0042127	0.821	regulation of cell population proliferation
GO:0042221	0.748	response to chemical
GO:0048584	0.727	positive regulation of response to stimulus
GO:0009966	0.720	regulation of signal transduction
GO:0048519	0.709	negative regulation of biological process
GO:0051239	0.690	regulation of multicellular organismal process
GO:0048523	0.687	negative regulation of cellular process
GO:0071704	0.678	organic substance metabolic process
GO:0023056	0.677	positive regulation of signaling
GO:0010647	0.677	positive regulation of cell communication
GO:0009967	0.671	positive regulation of signal transduction
GO:0008284	0.658	positive regulation of cell population proliferation
GO:0070887	0.653	cellular response to chemical stimulus
GO:0051240	0.638	positive regulation of multicellular organismal process
GO:0010033	0.607	response to organic substance
GO:0065008	0.583	regulation of biological quality
GO:0007167	0.544	enzyme-linked receptor protein signaling pathway
GO:0044237	0.536	cellular metabolic process
GO:0044238	0.535	primary metabolic process
GO:0071310	0.510	cellular response to organic substance
GO:0044093	0.449	positive regulation of molecular function
GO:0002682	0.426	regulation of immune system process
GO:0050865	0.400	regulation of cell activation
GO:0006807	0.395	nitrogen compound metabolic process
GO:0007169	0.395	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0002694	0.375	regulation of leukocyte activation
GO:0007275	0.374	multicellular organism development
GO:0010468	0.362	regulation of gene expression
GO:0051249	0.360	regulation of lymphocyte activation
GO:0050790	0.350	regulation of catalytic activity
GO:0002696	0.349	positive regulation of leukocyte activation
GO:0043170	0.345	macromolecule metabolic process
GO:1901564	0.340	organonitrogen compound metabolic process
GO:0051251	0.339	positive regulation of lymphocyte activation
GO:0050793	0.310	regulation of developmental process
GO:0070663	0.308	regulation of leukocyte proliferation
GO:0071345	0.306	cellular response to cytokine stimulus
GO:0070665	0.304	positive regulation of leukocyte proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.840	intracellular anatomical structure
GO:0005737	0.829	cytoplasm
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0070013	0.567	intracellular organelle lumen
GO:0012505	0.550	endomembrane system
GO:0005576	0.455	extracellular region
GO:0031904	0.389	endosome lumen
GO:0009986	0.387	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]