StarFunc result for job id P16499

User Input

>input (860 residues)
MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEI
IFDLLRDFQENLQTEKCIFNVMKKLCFLLQADRMSLFMYRTRNGIAELATRLFNVHKDAV
LEDCLVMPDQEIVFPLDMGIVGHVAHSKKIANVPNTEEDEHFCDFVDILTEYKTKNILAS
PIMNGKDVVAIIMAVNKVDGSHFTKRDEEILLKYLNFANLIMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPAYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKMKVQEEKKQKQQSAKSAAAGN
QPGGNPSPGGATTSKSCCIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7jsnA	0.928	0.972	0.000	820	0.900	0.944	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
2	AFDB:D3ZDI8	0.887	0.891	0.000	856	0.726	0.729	D3ZDI8.pdb.gz	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
3	AFDB:P16499	1.000	1.000	0.000	860	1.000	1.000	P16499.pdb.gz	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
4	AFDB:P51160	0.973	0.975	2.809E-100	858	0.636	0.638	P51160.pdb.gz	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
5	AFDB:Q91ZQ1	0.482	0.481	9.854E-96	861	0.620	0.619	Q91ZQ1.pdb.gz	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
6	AFDB:A0A0R4IUY2	0.897	0.905	6.071E-95	852	0.588	0.594	A0A0R4IUY2.pdb.gz
7	PDB:6mzbB	0.874	0.930	4.243E-92	807	0.701	0.747	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
8	AFDB:Q9VFI9	0.682	0.537	2.097E-55	1118	0.302	0.233	Q9VFI9.pdb.gz	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
9	AFDB:Q8VID6	0.596	0.556	9.504E-54	935	0.306	0.281	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
10	AFDB:Q9VJ79	0.639	0.402	1.768E-53	1451	0.283	0.167	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
11	AFDB:O76074	0.613	0.603	5.657E-50	875	0.299	0.294	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
12	AFDB:B3VTJ2	0.390	0.358	5.354E-40	941	0.219	0.200	B3VTJ2.pdb.gz	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
13	PDB:3bjcA	0.332	0.893	3.027E-21	311	0.151	0.418	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
14	PDB:4y86B	0.358	0.924	2.351E-17	326	0.101	0.267	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
15	PDB:1f5mB	0.144	0.568	2.684E-4	177	0.036	0.175	1f5mB.pdb.gz
16	PDB:1vhmB	0.145	0.667	1.015E-3	160	0.031	0.169	1vhmB.pdb.gz
17	PDB:7rzwB	0.195	0.194	3.076E-3	864	0.070	0.069	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
18	PDB:5loeA	0.139	0.371	6.834E-3	258	0.036	0.120	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
19	PDB:4zmuA	0.144	0.332	8.160E-3	341	0.033	0.082	4zmuA.pdb.gz
20	PDB:6cbqA	0.139	0.431	5.493E-2	234	0.024	0.090	6cbqA.pdb.gz	Mechanism of agonism and antagonism of the Pseudomonas aeruginosa quorum sensing regulator QscR with non-native ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZDI8	0.0	1299	856	0.728	0.731	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
2	P11541	0.0	1639	859	0.934	0.935	PDE6A_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Bos taurus OX=9913 GN=PDE6A PE=1 SV=3
3	P16499	0.0	1803	860	1.000	1.000	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
4	P23439	0.0	1314	853	0.724	0.730	PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus OX=9913 GN=PDE6B PE=1 SV=1
5	P23440	0.0	1293	856	0.722	0.725	PDE6B_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Mus musculus OX=10090 GN=Pde6b PE=2 SV=3
6	P27664	0.0	1655	859	0.948	0.949	PDE6A_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Mus musculus OX=10090 GN=Pde6a PE=2 SV=3
7	P35913	0.0	1291	854	0.715	0.720	PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens OX=9606 GN=PDE6B PE=1 SV=2
8	P51160	0.0	1175	858	0.637	0.639	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
9	Q6P4P8	0.0	1077	852	0.578	0.583	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
10	Q91ZQ1	0.0	1119	861	0.621	0.620	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
11	Q8VID6	7.57e-141	442	935	0.287	0.264	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
12	Q9HCR9	6.55e-139	437	933	0.288	0.266	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
13	Q9VFI9	6.87e-139	442	1118	0.295	0.227	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
14	Q9VJ79	6.32e-127	417	1451	0.281	0.167	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
15	O54735	3.37e-125	399	833	0.294	0.304	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
16	O76074	2.60e-124	397	875	0.294	0.289	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
17	Q8CG03	3.05e-124	397	865	0.299	0.297	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
18	G1U4Q4	2.41e-73	261	936	0.222	0.204	G1U4Q4_RABIT Phosphodiesterase OS=Oryctolagus cuniculus OX=9986 GN=PDE2A PE=3 SV=2
19	B3VTJ2	2.51e-73	261	941	0.227	0.207	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
20	P14099	6.16e-73	259	921	0.224	0.210	PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	5.6e-22	90.2	GAF domain
2	PF13185 GAF_2	1.7e-05	36.5	GAF domain
3	PF13492 GAF_3	5.1	19.0	GAF domain
4	PF00233 PDEase_I	4.9e-68	240.9	3'5'-cyclic nucleotide phosphodiesterase
5	PF15714 SpoVT_C	10	17.6	Stage V sporulation protein T C-terminal, transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255266

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328412	0.999	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
2	9606.ENSP00000251102	0.998	Cyclic nucleotide-gated cation channel beta-1
3	9606.ENSP00000384264	0.979	cGMP-gated cation channel alpha-1
4	9606.ENSP00000232461	0.971	Guanine nucleotide-binding protein G(t) subunit alpha-1
5	9606.ENSP00000266395	0.969	Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
6	9606.ENSP00000420295	0.969	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
7	9606.ENSP00000334134	0.946	Regulator of G-protein signaling 9-binding protein
8	9606.ENSP00000261837	0.940	Guanine nucleotide-binding protein subunit beta-5
9	9606.ENSP00000262406	0.938	Regulator of G-protein signaling 9
10	9606.ENSP00000316605	0.891	Cyclic nucleotide-gated cation channel beta-3
11	9606.ENSP00000254854	0.887	Retinal guanylyl cyclase 1
12	9606.ENSP00000248572	0.879	Guanine nucleotide-binding protein G(T) subunit gamma-T1
13	9606.ENSP00000251337	0.874	Guanine nucleotide-binding protein G(t) subunit alpha-2
14	9606.ENSP00000370521	0.861	Aryl-hydrocarbon-interacting protein-like 1
15	9606.ENSP00000481878	0.819	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
16	9606.ENSP00000218006	0.801	Retinal guanylyl cyclase 2
17	9606.ENSP00000356825	0.788	Adenylate cyclase type 10
18	9606.ENSP00000264424	0.782	Guanylate cyclase soluble subunit beta-1
19	9606.ENSP00000341083	0.776	Atrial natriuretic peptide receptor 2
20	9606.ENSP00000294016	0.774	Adenylate cyclase type 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	0.995	3',5'-cyclic-GMP phosphodiesterase activity
GO:0005488	0.990	binding
GO:0005515	0.966	protein binding
GO:0004115	0.942	3',5'-cyclic-AMP phosphodiesterase activity
GO:1901363	0.556	heterocyclic compound binding
GO:0097159	0.548	organic cyclic compound binding
GO:0030551	0.477	cyclic nucleotide binding
GO:0032555	0.445	purine ribonucleotide binding
GO:0043168	0.434	anion binding
GO:0030553	0.409	cGMP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0050953	0.974	sensory perception of light stimulus
GO:0007601	0.956	visual perception
GO:0009987	0.858	cellular process
GO:0048513	0.698	animal organ development
GO:0065007	0.641	biological regulation
GO:0050896	0.598	response to stimulus
GO:0050789	0.587	regulation of biological process
GO:0050794	0.579	regulation of cellular process
GO:0007275	0.574	multicellular organism development
GO:0051716	0.524	cellular response to stimulus
GO:0023052	0.508	signaling
GO:0007154	0.508	cell communication
GO:0007165	0.490	signal transduction
GO:0060249	0.424	anatomical structure homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005929	0.998	cilium
GO:0031090	0.995	organelle membrane
GO:0097733	0.991	photoreceptor cell cilium
GO:0001750	0.979	photoreceptor outer segment
GO:0097381	0.900	photoreceptor disc membrane
GO:0005622	0.747	intracellular anatomical structure
GO:0005737	0.518	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16957	0.995	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.995	3',5'-cyclic-GMP phosphodiesterase.
RHEA:25277	0.942	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.942	3',5'-cyclic-AMP phosphodiesterase.

[back to server]