StarFunc result for job id P16581

User Input

>input (610 residues)
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16581	1.000	1.000	0.000	610	1.000	1.000	P16581.pdb.gz	LYAM2_HUMAN E-selectin OS=Homo sapiens OX=9606 GN=SELE PE=1 SV=1
2	AFDB:Q00690	0.575	0.573	2.833E-94	612	0.731	0.729	Q00690.pdb.gz	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
3	AFDB:P98105	0.597	0.659	5.193E-82	549	0.666	0.740	P98105.pdb.gz	LYAM2_RAT E-selectin OS=Rattus norvegicus OX=10116 GN=Sele PE=2 SV=1
4	AFDB:Q01102	0.291	0.241	5.125E-70	768	0.433	0.344	Q01102.pdb.gz	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
5	AFDB:P16109	0.684	0.525	1.233E-69	830	0.393	0.289	P16109.pdb.gz	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
6	AFDB:P98106	0.343	0.282	6.106E-69	768	0.436	0.346	P98106.pdb.gz	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
7	AFDB:E5DV48	0.468	0.344	3.350E-63	868	0.372	0.262	E5DV48.pdb.gz	E5DV48_DANRE P-selectin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-260g14.4 PE=2 SV=1
8	AFDB:Q9VYR4	0.317	0.177	1.162E-39	1174	0.221	0.115	Q9VYR4.pdb.gz	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
9	AFDB:P18337	0.447	0.715	1.186E-38	372	0.241	0.395	P18337.pdb.gz	LYAM1_MOUSE L-selectin OS=Mus musculus OX=10090 GN=Sell PE=1 SV=1
10	AFDB:P30836	0.306	0.495	1.987E-38	372	0.238	0.390	P30836.pdb.gz	LYAM1_RAT L-selectin OS=Rattus norvegicus OX=10116 GN=Sell PE=2 SV=1
11	PDB:2gsxA	0.139	0.101	9.223E-26	951	0.179	0.115	2gsxA.pdb.gz
12	PDB:2q7zA	0.162	0.067	1.452E-23	1931	0.182	0.057	2q7zA.pdb.gz
13	PDB:1c1zA	0.252	0.427	1.643E-22	326	0.133	0.248	1c1zA.pdb.gz
14	PDB:1haqA	0.201	0.118	1.167E-16	1213	0.133	0.067	1haqA.pdb.gz
15	PDB:8a7eC	0.211	0.099	5.782E-16	1524	0.138	0.055	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.142	0.125	9.983E-12	714	0.069	0.059	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:7nycC	0.186	0.147	3.074E-9	809	0.116	0.088	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:8a7dQ	0.115	0.222	6.015E-9	273	0.069	0.154	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
19	PDB:3t5oA	0.155	0.115	3.858E-8	871	0.077	0.054	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:4e0sB	0.110	0.082	9.278E-8	898	0.079	0.053	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16581	0.0	1252	610	1.000	1.000	LYAM2_HUMAN E-selectin OS=Homo sapiens OX=9606 GN=SELE PE=1 SV=1
2	P98105	0.0	720	549	0.567	0.630	LYAM2_RAT E-selectin OS=Rattus norvegicus OX=10116 GN=Sele PE=2 SV=1
3	Q00690	0.0	902	612	0.725	0.722	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
4	P16109	9.66e-167	498	830	0.393	0.289	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
5	Q01102	1.41e-165	493	768	0.395	0.314	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
6	P98106	1.95e-162	485	768	0.393	0.312	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
7	E5DV48	3.43e-150	456	868	0.375	0.264	E5DV48_DANRE P-selectin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-260g14.4 PE=2 SV=1
8	P18337	6.55e-103	318	372	0.246	0.403	LYAM1_MOUSE L-selectin OS=Mus musculus OX=10090 GN=Sell PE=1 SV=1
9	P98131	5.10e-102	316	370	0.243	0.400	LYAM1_BOVIN L-selectin OS=Bos taurus OX=9913 GN=SELL PE=2 SV=1
10	P14151	5.80e-102	316	372	0.241	0.395	LYAM1_HUMAN L-selectin OS=Homo sapiens OX=9606 GN=SELL PE=1 SV=2
11	P30836	1.27e-89	284	372	0.213	0.349	LYAM1_RAT L-selectin OS=Rattus norvegicus OX=10116 GN=Sell PE=2 SV=1
12	Q80T79	2.26e-49	187	3707	0.205	0.034	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
13	A2AVA0	2.42e-46	179	3567	0.198	0.034	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
14	P91658	9.13e-44	170	974	0.252	0.158	P91658_DROME Furrowed OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
15	Q923L3	1.23e-43	171	3564	0.174	0.030	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
16	Q9VYR4	6.77e-43	167	1174	0.256	0.133	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
17	Q4LDE5	1.36e-42	167	3571	0.187	0.032	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
18	Q96PZ7	2.10e-40	160	3564	0.179	0.031	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
19	A0A1D5NSM8	3.78e-38	154	3615	0.157	0.027	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
20	A8JUT1	8.96e-38	151	755	0.156	0.126	A8JUT1_DROME Furrowed, isoform B OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.013	27.1	EGF-like domain
2	PF07974 EGF_2	5.2	18.8	EGF-like domain
3	PF12947 EGF_3	83	14.8	EGF domain
4	PF12661 hEGF	0.68	21.9	Human growth factor-like EGF
5	PF00059 Lectin_C	1e-21	89.0	Lectin C-type domain
6	PF06247 Plasmod_Pvs28	65	15.2	Pvs28 EGF domain
7	PF00084 Sushi	4.5e-51	182.4	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331736

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000205061	0.998	Golgi apparatus protein 1
2	9606.ENSP00000228463	0.998	P-selectin glycoprotein ligand 1
3	9606.ENSP00000398632	0.997	CD44 antigen
4	9606.ENSP00000353238	0.995	Leukosialin
5	9606.ENSP00000484824	0.969	Mucin-1
6	9606.ENSP00000318142	0.933	Alpha-(1,3)-fucosyltransferase 7
7	9606.ENSP00000333769	0.932	Basigin
8	9606.ENSP00000294728	0.924	Vascular cell adhesion protein 1
9	9606.ENSP00000264832	0.916	Intercellular adhesion molecule 1
10	9606.ENSP00000367013	0.906	Tumor necrosis factor receptor superfamily member 25
11	9606.ENSP00000351602	0.900	Alpha-(1,3)-fucosyltransferase 4
12	9606.ENSP00000356630	0.890	Headcase protein homolog
13	9606.ENSP00000398698	0.838	Tumor necrosis factor
14	9606.ENSP00000385675	0.819	Interleukin-6
15	9606.ENSP00000255030	0.811	C-reactive protein
16	9606.ENSP00000261405	0.806	Von Willebrand factor
17	9606.ENSP00000262776	0.796	Galectin-3-binding protein
18	9606.ENSP00000225831	0.784	C-C motif chemokine 2
19	9606.ENSP00000306512	0.775	Interleukin-8
20	9606.ENSP00000457421	0.768	Platelet endothelial cell adhesion molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070492	0.999	oligosaccharide binding
GO:0033691	0.999	sialic acid binding
GO:0019899	0.998	enzyme binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0043274	0.981	phospholipase binding
GO:0008289	0.694	lipid binding
GO:0005102	0.631	signaling receptor binding
GO:0051861	0.515	glycolipid binding
GO:0005539	0.510	glycosaminoglycan binding
GO:0008201	0.473	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.992	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0007155	0.932	cell adhesion
GO:0050900	0.930	leukocyte migration
GO:0006950	0.921	response to stress
GO:0048522	0.889	positive regulation of cellular process
GO:0051716	0.869	cellular response to stimulus
GO:0042221	0.867	response to chemical
GO:2000145	0.867	regulation of cell motility
GO:0098609	0.861	cell-cell adhesion
GO:0007154	0.818	cell communication
GO:0023052	0.803	signaling
GO:0030334	0.771	regulation of cell migration
GO:0007165	0.763	signal transduction
GO:0048583	0.747	regulation of response to stimulus
GO:0010033	0.687	response to organic substance
GO:0002682	0.640	regulation of immune system process
GO:0009605	0.611	response to external stimulus
GO:0065009	0.595	regulation of molecular function
GO:0006952	0.593	defense response
GO:0040017	0.540	positive regulation of locomotion
GO:0051707	0.526	response to other organism
GO:0044093	0.517	positive regulation of molecular function
GO:0034097	0.496	response to cytokine
GO:0050790	0.495	regulation of catalytic activity
GO:0006954	0.494	inflammatory response
GO:0070887	0.432	cellular response to chemical stimulus
GO:0048584	0.429	positive regulation of response to stimulus
GO:0032502	0.428	developmental process
GO:2000147	0.427	positive regulation of cell motility
GO:0019222	0.423	regulation of metabolic process
GO:0032501	0.407	multicellular organismal process
GO:0032101	0.402	regulation of response to external stimulus
GO:0043085	0.390	positive regulation of catalytic activity
GO:0032879	0.367	regulation of localization
GO:0009893	0.355	positive regulation of metabolic process
GO:1901700	0.352	response to oxygen-containing compound
GO:0048519	0.350	negative regulation of biological process
GO:0060255	0.350	regulation of macromolecule metabolic process
GO:0048856	0.341	anatomical structure development
GO:0030335	0.341	positive regulation of cell migration
GO:0080134	0.337	regulation of response to stress
GO:0051049	0.324	regulation of transport
GO:0030155	0.305	regulation of cell adhesion
GO:0051128	0.304	regulation of cellular component organization
GO:0007159	0.304	leukocyte cell-cell adhesion
GO:0045123	0.300	cellular extravasation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.974	organelle
GO:0005576	0.969	extracellular region
GO:0005622	0.966	intracellular anatomical structure
GO:0043229	0.951	intracellular organelle
GO:0005737	0.927	cytoplasm
GO:0005615	0.900	extracellular space
GO:0012505	0.886	endomembrane system
GO:0043227	0.837	membrane-bounded organelle
GO:0043231	0.778	intracellular membrane-bounded organelle
GO:0009986	0.510	cell surface
GO:0031982	0.358	vesicle
GO:0043232	0.314	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]