StarFunc result for job id P16591

User Input

>input (822 residues)
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
IEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
EELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVVLLNPIPKDKKWILSHEDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQ
LVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
APQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09760	0.799	0.798	0.000	823	0.932	0.931	P09760.pdb.gz	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
2	AFDB:A0A2R8QR19	0.513	0.490	7.686E-102	862	0.773	0.737	A0A2R8QR19.pdb.gz
3	AFDB:A2CES6	0.589	0.576	8.238E-97	842	0.745	0.727	A2CES6.pdb.gz
4	AFDB:D4A584	0.462	0.462	2.550E-78	822	0.504	0.504	D4A584.pdb.gz	D4A584_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
5	AFDB:P18106	0.478	0.307	5.252E-56	1325	0.392	0.243	P18106.pdb.gz	FER_DROME Tyrosine-protein kinase Fer OS=Drosophila melanogaster OX=7227 GN=FER PE=1 SV=3
6	AFDB:Q22146	0.420	0.857	2.955E-34	390	0.167	0.351	Q22146.pdb.gz	FRK1_CAEEL Fer-related kinase 1 OS=Caenorhabditis elegans OX=6239 GN=frk-1 PE=1 SV=1
7	AFDB:E9PT20	0.313	0.226	6.004E-33	1143	0.197	0.142	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
8	AFDB:P42679	0.322	0.511	6.587E-33	507	0.178	0.288	P42679.pdb.gz	MATK_HUMAN Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1
9	AFDB:Q8INJ8	0.331	0.264	9.543E-33	1052	0.192	0.150	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
10	AFDB:A0A024R8E2	0.313	0.229	1.047E-32	1130	0.180	0.131	A0A024R8E2.pdb.gz
11	PDB:1k9aB	0.309	0.554	3.427E-28	441	0.170	0.317	1k9aB.pdb.gz
12	PDB:2h8hA	0.298	0.539	2.021E-26	445	0.184	0.339	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.289	0.423	2.968E-25	555	0.163	0.241	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.293	0.432	2.913E-23	551	0.156	0.232	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:2qkwB	0.294	0.770	3.256E-15	292	0.094	0.264	2qkwB.pdb.gz
16	PDB:8dksA	0.263	0.722	6.523E-15	283	0.091	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:4eomC	0.282	0.797	1.369E-14	276	0.080	0.239	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:6b1uA	0.281	0.507	1.502E-14	442	0.083	0.154	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:5ufuA	0.279	0.597	2.743E-14	369	0.085	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:4krcA	0.286	0.748	4.162E-14	297	0.073	0.202	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZWJ2	0.0	751	781	0.485	0.511	A0A8I5ZWJ2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
2	D4A584	0.0	796	822	0.505	0.505	D4A584_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
3	P07332	0.0	764	822	0.511	0.511	FES_HUMAN Tyrosine-protein kinase Fes/Fps OS=Homo sapiens OX=9606 GN=FES PE=1 SV=3
4	P09760	0.0	1591	823	0.933	0.932	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
5	P16591	0.0	1698	822	1.000	1.000	FER_HUMAN Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER PE=1 SV=2
6	P16879	0.0	790	822	0.505	0.505	FES_MOUSE Tyrosine-protein kinase Fes/Fps OS=Mus musculus OX=10090 GN=Fes PE=1 SV=2
7	P70451	0.0	1594	823	0.931	0.930	FER_MOUSE Tyrosine-protein kinase Fer OS=Mus musculus OX=10090 GN=Fer PE=1 SV=2
8	W0S0X4	0.0	1698	822	1.000	1.000	W0S0X4_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=Pe1Fe3 PE=2 SV=1
9	P18106	2.68e-129	420	1325	0.245	0.152	FER_DROME Tyrosine-protein kinase Fer OS=Drosophila melanogaster OX=7227 GN=FER PE=1 SV=3
10	P00520	3.36e-86	299	1123	0.184	0.134	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
11	F7BN18	4.16e-86	298	1128	0.182	0.133	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
12	Q2PYT4	6.20e-86	298	1143	0.184	0.132	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
13	E9PT20	6.26e-86	298	1143	0.184	0.132	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
14	P00519	7.47e-86	298	1130	0.184	0.134	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
15	U6DU97	1.10e-85	272	198	0.161	0.667	U6DU97_NEOVI Tyrosine-protein kinase (Fragment) OS=Neovison vison OX=452646 GN=FES PE=2 SV=1
16	Q22146	2.09e-84	276	390	0.178	0.374	FRK1_CAEEL Fer-related kinase 1 OS=Caenorhabditis elegans OX=6239 GN=frk-1 PE=1 SV=1
17	P42684	3.98e-84	293	1182	0.184	0.128	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
18	Q4JIM5	8.55e-84	293	1182	0.184	0.128	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
19	P03949	5.37e-83	291	1224	0.182	0.123	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
20	P00522	2.03e-81	288	1620	0.184	0.093	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0074	27.0	ABC1 atypical kinase-like domain
2	PF00611 FCH	1.4e-07	43.1	Fes/CIP4, and EFC/F-BAR homology domain
3	PF03033 Glyco_transf_28	7.7e+02	11.5	Glycosyltransferase family 28 N-terminal domain
4	PF19304 PGDH_inter	3.2e+02	12.9	D-3-phosphoglycerate dehydrogenase intervening domain
5	PF00069 Pkinase	9.5e-46	167.9	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	2.6e-96	333.5	Protein tyrosine and serine/threonine kinase
7	PF00017 SH2	5.8e-18	76.1	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281092

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365745	0.963	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
2	9606.ENSP00000382004	0.960	Catenin delta-1
3	9606.ENSP00000344456	0.947	Catenin beta-1
4	9606.ENSP00000228280	0.939	Kit ligand
5	9606.ENSP00000288135	0.938	Mast/stem cell growth factor receptor Kit
6	9606.ENSP00000341208	0.937	Signal transducer and activator of transcription 5A
7	9606.ENSP00000261769	0.927	Cadherin-1
8	9606.ENSP00000377508	0.927	Junction plakoglobin
9	9606.ENSP00000360683	0.918	Tyrosine-protein phosphatase non-receptor type 1
10	9606.ENSP00000364907	0.916	Tyrosine-protein kinase SYK
11	9606.ENSP00000340944	0.915	Tyrosine-protein phosphatase non-receptor type 11
12	9606.ENSP00000428924	0.914	Tyrosine-protein kinase Lyn
13	9606.ENSP00000269141	0.907	Cadherin-2
14	9606.ENSP00000289902	0.904	High affinity immunoglobulin epsilon receptor subunit gamma
15	9606.ENSP00000304669	0.903	Catenin alpha-1
16	9606.ENSP00000278888	0.901	High affinity immunoglobulin epsilon receptor subunit beta
17	9606.ENSP00000357097	0.901	High affinity immunoglobulin epsilon receptor subunit alpha
18	9606.ENSP00000462468	0.827	Tyrosine-protein kinase Yes
19	9606.ENSP00000350377	0.609	Multiple C2 and transmembrane domain-containing protein 2
20	9606.ENSP00000275493	0.567	Epidermal growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0050839	0.898	cell adhesion molecule binding
GO:0005102	0.869	signaling receptor binding
GO:0008092	0.838	cytoskeletal protein binding
GO:0019900	0.767	kinase binding
GO:0019901	0.746	protein kinase binding
GO:0019902	0.729	phosphatase binding
GO:0019903	0.688	protein phosphatase binding
GO:0070851	0.680	growth factor receptor binding
GO:0005154	0.654	epidermal growth factor receptor binding
GO:0042802	0.552	identical protein binding
GO:0008157	0.526	protein phosphatase 1 binding
GO:0004715	0.523	non-membrane spanning protein tyrosine kinase activity
GO:0045296	0.448	cadherin binding
GO:1990782	0.337	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050896	0.986	response to stimulus
GO:0050794	0.984	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0016043	0.977	cellular component organization
GO:0019222	0.970	regulation of metabolic process
GO:0007165	0.970	signal transduction
GO:0048518	0.969	positive regulation of biological process
GO:0007169	0.957	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310	0.956	phosphorylation
GO:0048583	0.952	regulation of response to stimulus
GO:0018108	0.942	peptidyl-tyrosine phosphorylation
GO:0032502	0.938	developmental process
GO:0048856	0.928	anatomical structure development
GO:0042221	0.927	response to chemical
GO:0046777	0.925	protein autophosphorylation
GO:0032501	0.923	multicellular organismal process
GO:0071310	0.913	cellular response to organic substance
GO:0044087	0.906	regulation of cellular component biogenesis
GO:0019221	0.904	cytokine-mediated signaling pathway
GO:0007275	0.892	multicellular organism development
GO:0048008	0.886	platelet-derived growth factor receptor signaling pathway
GO:0010243	0.871	response to organonitrogen compound
GO:0032970	0.858	regulation of actin filament-based process
GO:0033043	0.855	regulation of organelle organization
GO:0043254	0.853	regulation of protein-containing complex assembly
GO:0048731	0.846	system development
GO:0060255	0.845	regulation of macromolecule metabolic process
GO:0040012	0.843	regulation of locomotion
GO:0030154	0.839	cell differentiation
GO:0080090	0.829	regulation of primary metabolic process
GO:0051171	0.828	regulation of nitrogen compound metabolic process
GO:0031323	0.824	regulation of cellular metabolic process
GO:0030334	0.817	regulation of cell migration
GO:0048522	0.815	positive regulation of cellular process
GO:0044093	0.811	positive regulation of molecular function
GO:1901700	0.798	response to oxygen-containing compound
GO:0048523	0.795	negative regulation of cellular process
GO:1902903	0.791	regulation of supramolecular fiber organization
GO:0032956	0.783	regulation of actin cytoskeleton organization
GO:0065008	0.781	regulation of biological quality
GO:0051239	0.771	regulation of multicellular organismal process
GO:0009719	0.770	response to endogenous stimulus
GO:0006996	0.753	organelle organization
GO:0010468	0.753	regulation of gene expression
GO:0002376	0.752	immune system process
GO:0008064	0.749	regulation of actin polymerization or depolymerization
GO:0032271	0.744	regulation of protein polymerization
GO:0071495	0.740	cellular response to endogenous stimulus
GO:0070848	0.738	response to growth factor
GO:0023051	0.736	regulation of signaling
GO:0002682	0.729	regulation of immune system process
GO:0010646	0.726	regulation of cell communication
GO:0009966	0.721	regulation of signal transduction
GO:0016477	0.716	cell migration
GO:0048584	0.674	positive regulation of response to stimulus
GO:0048468	0.639	cell development
GO:0007010	0.618	cytoskeleton organization
GO:0120035	0.614	regulation of plasma membrane bounded cell projection organization
GO:0045216	0.586	cell-cell junction organization
GO:0009893	0.574	positive regulation of metabolic process
GO:0031326	0.538	regulation of cellular biosynthetic process
GO:0010556	0.532	regulation of macromolecule biosynthetic process
GO:0051246	0.520	regulation of protein metabolic process
GO:0006355	0.503	regulation of DNA-templated transcription
GO:0051179	0.497	localization
GO:0042127	0.497	regulation of cell population proliferation
GO:0022607	0.496	cellular component assembly
GO:0010604	0.482	positive regulation of macromolecule metabolic process
GO:0051174	0.480	regulation of phosphorus metabolic process
GO:0034332	0.469	adherens junction organization
GO:0000003	0.468	reproduction
GO:0031325	0.462	positive regulation of cellular metabolic process
GO:1901701	0.426	cellular response to oxygen-containing compound
GO:0051173	0.408	positive regulation of nitrogen compound metabolic process
GO:0023056	0.402	positive regulation of signaling
GO:0009888	0.395	tissue development
GO:0050776	0.377	regulation of immune response
GO:0010647	0.375	positive regulation of cell communication
GO:0022414	0.374	reproductive process
GO:0048513	0.351	animal organ development
GO:0060429	0.341	epithelium development
GO:0031399	0.335	regulation of protein modification process
GO:0019220	0.324	regulation of phosphate metabolic process
GO:0051247	0.308	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005886	0.976	plasma membrane
GO:0043229	0.973	intracellular organelle
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0005634	0.328	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.523	non-specific protein-tyrosine kinase.

[back to server]