StarFunc result for job id P16615

User Input

>input (1042 residues)
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
NPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVL
LIMPLVIWVYSTDTNFSDMFWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5zmwA	0.679	0.705	0.000	1000	0.801	0.835	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
2	PDB:7e7sA	0.693	0.706	0.000	1020	0.976	0.997	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
3	AFDB:A0A0R4IQS8	0.993	0.994	0.000	1041	0.875	0.876	A0A0R4IQS8.pdb.gz	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
4	AFDB:A9C3Q4	0.983	0.983	0.000	1042	0.858	0.858	A9C3Q4.pdb.gz
5	AFDB:G5EEK8	0.928	0.913	0.000	1059	0.682	0.671	G5EEK8.pdb.gz	G5EEK8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
6	AFDB:O14983	0.944	0.982	0.000	1001	0.803	0.836	O14983.pdb.gz	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
7	AFDB:O55143	0.998	0.996	0.000	1044	0.987	0.985	O55143.pdb.gz	AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus OX=10090 GN=Atp2a2 PE=1 SV=2
8	AFDB:P18596	0.946	0.987	0.000	999	0.737	0.769	P18596.pdb.gz	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
9	AFDB:P22700	0.947	0.967	0.000	1020	0.694	0.709	P22700.pdb.gz	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
10	AFDB:Q5U3A4	0.948	0.983	0.000	1005	0.781	0.810	Q5U3A4.pdb.gz
11	AFDB:Q9SY55	0.908	0.948	0.000	998	0.521	0.544	Q9SY55.pdb.gz	ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA3 PE=1 SV=3
12	AFDB:Q9UUY0	0.844	0.879	0.000	997	0.533	0.557	Q9UUY0.pdb.gz	Q9UUY0_NEUCS Putative calcium P-type ATPase (Fragment) OS=Neurospora crassa OX=5141 GN=nca-1 PE=4 SV=1
13	PDB:7x20A	0.809	0.852	1.787E-55	986	0.266	0.281	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
14	PDB:8d3xA	0.808	0.850	2.878E-55	989	0.270	0.284	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
15	PDB:3ixzA	0.797	0.829	1.776E-54	998	0.273	0.285	3ixzA.pdb.gz
16	PDB:3b8eA	0.793	0.826	1.247E-53	998	0.266	0.278	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
17	PDB:6a69A	0.549	0.616	9.760E-43	911	0.255	0.292	6a69A.pdb.gz
18	PDB:7vpkA	0.714	0.706	1.386E-36	1055	0.183	0.181	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.465	0.579	2.508E-34	804	0.195	0.252	7vh5A.pdb.gz
20	PDB:7m5xA	0.676	0.703	7.095E-34	1000	0.176	0.183	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQS8	1843	1041	0.875	0.876	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
2	A8WI68	1282	932	0.597	0.667	A8WI68_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
3	B6CAM1	1703	994	0.802	0.841	B6CAM1_RABIT Calcium-transporting ATPase OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
4	G5EEK8	1448	1059	0.680	0.669	G5EEK8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
5	O14983	1700	1001	0.804	0.837	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
6	O23087	875	1054	0.498	0.492	ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA2 PE=1 SV=1
7	O55143	2123	1044	0.988	0.987	AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus OX=10090 GN=Atp2a2 PE=1 SV=2
8	P04191	1704	1001	0.802	0.835	AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus OX=9986 GN=ATP2A1 PE=1 SV=1
9	P11507	2129	1043	0.990	0.989	AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2a2 PE=1 SV=1
10	P11607	2137	1042	0.990	0.990	AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa OX=9823 GN=ATP2A2 PE=1 SV=1
11	P16615	2151	1042	1.000	1.000	AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1
12	P18596	1578	999	0.738	0.770	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
13	P22700	1457	1020	0.688	0.703	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
14	P92939	890	1061	0.497	0.488	ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA1 PE=1 SV=2
15	Q03669	2002	1041	0.939	0.939	AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus OX=9031 GN=ATP2A2 PE=2 SV=2
16	Q57Z55	850	1011	0.473	0.488	Q57Z55_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.570 PE=3 SV=1
17	Q642Z0	1660	994	0.781	0.819	Q642Z0_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=cb279 PE=1 SV=1
18	Q64518	1598	999	0.745	0.777	AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus OX=10090 GN=Atp2a3 PE=1 SV=4
19	Q64578	1702	994	0.801	0.840	AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2a1 PE=1 SV=1
20	Q6ZM60	1826	1035	0.869	0.875	Q6ZM60_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	2.2e-16	71.0	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	3.4e-43	159.0	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	1.4e-13	61.7	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	1.5e-51	186.0	E1-E2 ATPase
5	PF12710 HAD	2.9	19.9	haloacid dehalogenase-like hydrolase
6	PF00702 Hydrolase	6.1e-15	67.6	haloacid dehalogenase-like hydrolase
7	PF08282 Hydrolase_3	0.027	25.8	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440045

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350132	0.991	Cardiac phospholamban
2	9606.ENSP00000252825	0.976	Sarcoplasmic reticulum histidine-rich calcium-binding protein
3	9606.ENSP00000345502	0.944	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
4	9606.ENSP00000247461	0.936	Calnexin
5	9606.ENSP00000256646	0.935	Neurogenic locus notch homolog protein 2
6	9606.ENSP00000355533	0.923	Ryanodine receptor 2
7	9606.ENSP00000263388	0.920	Neurogenic locus notch homolog protein 3
8	9606.ENSP00000277541	0.915	Neurogenic locus notch homolog protein 1
9	9606.ENSP00000356790	0.904	Sodium/potassium-transporting ATPase subunit beta-1
10	9606.ENSP00000364163	0.903	Neurogenic locus notch homolog protein 4
11	9606.ENSP00000363435	0.887	Inositol 1,4,5-trisphosphate receptor type 3
12	9606.ENSP00000351957	0.866	cGMP-inhibited 3',5'-cyclic phosphodiesterase A
13	9606.ENSP00000481244	0.849	Phospholemman
14	9606.ENSP00000286371	0.830	Sodium/potassium-transporting ATPase subunit beta-3
15	9606.ENSP00000435380	0.824	Sarcolipin
16	9606.ENSP00000349595	0.822	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
17	9606.ENSP00000250111	0.821	Sodium/potassium-transporting ATPase subunit beta-2
18	9606.ENSP00000382518	0.821	Sarcalumenin
19	9606.ENSP00000263980	0.820	Sodium/hydrogen exchanger 1
20	9606.ENSP00000352608	0.820	Ryanodine receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005388	0.999	P-type calcium transporter activity
GO:0005515	0.998	protein binding
GO:0043167	0.694	ion binding
GO:0097159	0.543	organic cyclic compound binding
GO:1901363	0.507	heterocyclic compound binding
GO:0015079	0.312	potassium ion transmembrane transporter activity
GO:0005509	0.304	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.974	regulation of biological process
GO:0032501	0.968	multicellular organismal process
GO:0044057	0.963	regulation of system process
GO:0050896	0.952	response to stimulus
GO:0009987	0.916	cellular process
GO:0048856	0.908	anatomical structure development
GO:0072359	0.891	circulatory system development
GO:1903522	0.873	regulation of blood circulation
GO:0008016	0.857	regulation of heart contraction
GO:0007507	0.847	heart development
GO:0060972	0.824	left/right pattern formation
GO:0050794	0.805	regulation of cellular process
GO:0009799	0.775	specification of symmetry
GO:0051179	0.744	localization
GO:0003143	0.741	embryonic heart tube morphogenesis
GO:0006811	0.655	monoatomic ion transport
GO:0030001	0.647	metal ion transport
GO:0090257	0.620	regulation of muscle system process
GO:0061371	0.577	determination of heart left/right asymmetry
GO:0003008	0.573	system process
GO:0006937	0.439	regulation of muscle contraction
GO:0051716	0.415	cellular response to stimulus
GO:0007154	0.413	cell communication
GO:0042592	0.356	homeostatic process
GO:0003012	0.353	muscle system process
GO:0048519	0.351	negative regulation of biological process
GO:0023052	0.331	signaling
GO:0055085	0.316	transmembrane transport
GO:0042221	0.315	response to chemical
GO:0034220	0.314	monoatomic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005783	0.997	endoplasmic reticulum
GO:0016528	0.986	sarcoplasm
GO:0016529	0.983	sarcoplasmic reticulum
GO:0098588	0.963	bounding membrane of organelle
GO:0032991	0.915	protein-containing complex
GO:0005789	0.914	endoplasmic reticulum membrane
GO:0071944	0.893	cell periphery
GO:0005886	0.722	plasma membrane
GO:0033017	0.673	sarcoplasmic reticulum membrane
GO:0098796	0.385	membrane protein complex
GO:0031982	0.346	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18105	0.999	ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate
EC:7.2.2.10	0.999	P-type Ca(2+) transporter.
RHEA:29463	0.312	K(+)(in) = K(+)(out)

[back to server]