StarFunc result for job id P16671

User Input

>input (472 residues)
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1B1	0.995	0.995	1.362E-100	472	1.000	1.000	A4D1B1.pdb.gz	A4D1B1_HUMAN CD36 antigen (Collagen type I receptor, thrombospondin receptor) OS=Homo sapiens OX=9606 GN=CD36 PE=2 SV=1
2	AFDB:Q07969	0.992	0.992	6.661E-94	472	0.869	0.869	Q07969.pdb.gz	CD36_RAT Platelet glycoprotein 4 OS=Rattus norvegicus OX=10116 GN=Cd36 PE=1 SV=3
3	PDB:5lgdA	0.842	0.994	1.926E-82	400	0.845	0.998	5lgdA.pdb.gz
4	AFDB:Q6DHC7	0.951	0.966	1.698E-67	465	0.515	0.523	Q6DHC7.pdb.gz	Q6DHC7_DANRE CD36 antigen OS=Danio rerio OX=7955 GN=zgc:92513 PE=2 SV=1
5	AFDB:Q8WTV0	0.890	0.767	2.440E-52	552	0.326	0.279	Q8WTV0.pdb.gz	SCRB1_HUMAN Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1 PE=1 SV=1
6	AFDB:Q8SQC1	0.896	0.834	2.584E-52	509	0.309	0.287	Q8SQC1.pdb.gz	SCRB1_PIG Scavenger receptor class B member 1 OS=Sus scrofa OX=9823 GN=SCARB1 PE=2 SV=1
7	AFDB:P97943	0.900	0.838	3.448E-52	509	0.309	0.287	P97943.pdb.gz	SCRB1_RAT Scavenger receptor class B member 1 OS=Rattus norvegicus OX=10116 GN=Scarb1 PE=1 SV=1
8	AFDB:Q8JGR8	0.927	0.827	1.227E-51	531	0.341	0.303	Q8JGR8.pdb.gz	Q8JGR8_DANRE Lysosome membrane protein 2 OS=Danio rerio OX=7955 GN=scarb2 PE=1 SV=1
9	AFDB:O35114	0.917	0.906	9.240E-51	478	0.333	0.328	O35114.pdb.gz	SCRB2_MOUSE Lysosome membrane protein 2 OS=Mus musculus OX=10090 GN=Scarb2 PE=1 SV=3
10	AFDB:Q14108	0.919	0.908	2.326E-50	478	0.328	0.324	Q14108.pdb.gz	SCRB2_HUMAN Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2 PE=1 SV=2
11	AFDB:Q9VM10	0.848	0.719	7.966E-46	563	0.254	0.213	Q9VM10.pdb.gz	Q9VM10_DROME Scavenger receptor acting in neural tissue and majority of rhodopsin is absent, isoform A OS=Drosophila melanogaster OX=7227 GN=santa-maria PE=1 SV=2
12	PDB:6i7sG	0.157	0.100	7.157E-3	863	0.053	0.029	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
13	PDB:1ln1A	0.058	0.107	3.599E-2	203	0.051	0.118	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
14	PDB:3ojiB	0.071	0.143	9.059E-2	185	0.038	0.097	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism
15	PDB:7qe7I	0.093	0.068	1.522E-1	742	0.076	0.049	7qe7I.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:4jf7A	0.098	0.094	1.918E-1	501	0.087	0.082	4jf7A.pdb.gz	Structure of the Parainfluenza Virus 5 (PIV5) Hemagglutinin-Neuraminidase (HN) Ectodomain.
17	PDB:3kdhA	0.070	0.135	2.872E-1	189	0.040	0.101	3kdhA.pdb.gz
18	PDB:3w9rA	0.059	0.128	2.872E-1	171	0.036	0.099	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
19	PDB:6serA	0.058	0.093	2.872E-1	245	0.047	0.090	6serA.pdb.gz
20	PDB:3fyxA	0.130	0.164	3.223E-1	340	0.066	0.091	3fyxA.pdb.gz	On the function and structure of synthetically modified porins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D1B1	0.0	976	472	1.000	1.000	A4D1B1_HUMAN CD36 antigen (Collagen type I receptor, thrombospondin receptor) OS=Homo sapiens OX=9606 GN=CD36 PE=2 SV=1
2	E7EU05	0.0	956	463	0.981	1.000	E7EU05_HUMAN CD36 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD36 PE=1 SV=2
3	E9PLT1	0.0	820	396	0.839	1.000	E9PLT1_HUMAN CD36 molecule OS=Homo sapiens OX=9606 GN=CD36 PE=1 SV=1
4	P16671	0.0	976	472	1.000	1.000	CD36_HUMAN Platelet glycoprotein 4 OS=Homo sapiens OX=9606 GN=CD36 PE=1 SV=2
5	Q07969	0.0	874	472	0.869	0.869	CD36_RAT Platelet glycoprotein 4 OS=Rattus norvegicus OX=10116 GN=Cd36 PE=1 SV=3
6	Q08857	0.0	856	472	0.841	0.841	CD36_MOUSE Platelet glycoprotein 4 OS=Mus musculus OX=10090 GN=Cd36 PE=1 SV=2
7	Q6DHC7	1.15e-178	510	465	0.519	0.527	Q6DHC7_DANRE CD36 antigen OS=Danio rerio OX=7955 GN=zgc:92513 PE=2 SV=1
8	E7EX47	2.79e-147	420	203	0.430	1.000	E7EX47_HUMAN CD36 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD36 PE=1 SV=1
9	P27615	8.93e-87	276	478	0.333	0.328	SCRB2_RAT Lysosome membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Scarb2 PE=1 SV=2
10	O35114	1.16e-85	273	478	0.324	0.320	SCRB2_MOUSE Lysosome membrane protein 2 OS=Mus musculus OX=10090 GN=Scarb2 PE=1 SV=3
11	Q8JGR8	1.57e-85	274	531	0.322	0.286	Q8JGR8_DANRE Lysosome membrane protein 2 OS=Danio rerio OX=7955 GN=scarb2 PE=1 SV=1
12	Q14108	3.29e-85	271	478	0.322	0.318	SCRB2_HUMAN Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2 PE=1 SV=2
13	B7ZKQ9	4.61e-85	271	481	0.314	0.308	B7ZKQ9_HUMAN SCARB1 protein OS=Homo sapiens OX=9606 GN=SCARB1 PE=1 SV=1
14	Q8WTV0	6.23e-84	270	552	0.314	0.268	SCRB1_HUMAN Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1 PE=1 SV=1
15	Q8SQC1	3.38e-81	262	509	0.303	0.281	SCRB1_PIG Scavenger receptor class B member 1 OS=Sus scrofa OX=9823 GN=SCARB1 PE=2 SV=1
16	P97943	4.19e-76	249	509	0.282	0.261	SCRB1_RAT Scavenger receptor class B member 1 OS=Rattus norvegicus OX=10116 GN=Scarb1 PE=1 SV=1
17	Q61009	1.55e-75	247	509	0.288	0.267	SCRB1_MOUSE Scavenger receptor class B member 1 OS=Mus musculus OX=10090 GN=Scarb1 PE=1 SV=1
18	F5H4X0	6.16e-75	245	499	0.280	0.265	F5H4X0_HUMAN Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1 PE=1 SV=1
19	Q27367	3.83e-50	180	491	0.227	0.218	CRQ_DROME Protein croquemort OS=Drosophila melanogaster OX=7227 GN=crq PE=1 SV=3
20	Q9VM10	9.28e-50	180	563	0.271	0.227	Q9VM10_DROME Scavenger receptor acting in neural tissue and majority of rhodopsin is absent, isoform A OS=Drosophila melanogaster OX=7227 GN=santa-maria PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01130 CD36	5.2e-146	498.5	CD36 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352071	0.991	Scavenger receptor cysteine-rich type 1 protein M130
2	9606.ENSP00000260356	0.989	Thrombospondin-1
3	9606.ENSP00000370767	0.982	Pancreatic secretory granule membrane major glycoprotein GP2
4	9606.ENSP00000346671	0.972	Tyrosine-protein kinase Fyn
5	9606.ENSP00000385523	0.964	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000287820	0.961	Peroxisome proliferator-activated receptor gamma
7	9606.ENSP00000383931	0.958	Platelet glycoprotein V
8	9606.ENSP00000264867	0.948	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
9	9606.ENSP00000265350	0.936	Mediator of RNA polymerase II transcription subunit 20
10	9606.ENSP00000231449	0.914	Interleukin-4
11	9606.ENSP00000274306	0.910	Granzyme A
12	9606.ENSP00000363929	0.909	Nuclear receptor coactivator 6
13	9606.ENSP00000419692	0.908	Retinoic acid receptor RXR-alpha
14	9606.ENSP00000304915	0.907	Interleukin-13
15	9606.ENSP00000229795	0.905	Mitogen-activated protein kinase 14
16	9606.ENSP00000399968	0.905	Nuclear receptor coactivator 2
17	9606.ENSP00000417401	0.905	Helicase with zinc finger domain 2
18	9606.ENSP00000217964	0.904	F-box-like/WD repeat-containing protein TBL1X
19	9606.ENSP00000262367	0.903	CREB-binding protein
20	9606.ENSP00000263253	0.903	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	0.998	lipid binding
GO:0005515	0.998	protein binding
GO:0005044	0.998	scavenger receptor activity
GO:0060089	0.997	molecular transducer activity
GO:0030228	0.995	lipoprotein particle receptor activity
GO:0030169	0.995	low-density lipoprotein particle binding
GO:0038023	0.982	signaling receptor activity
GO:0005041	0.867	low-density lipoprotein particle receptor activity
GO:0038187	0.727	pattern recognition receptor activity
GO:0008035	0.658	high-density lipoprotein particle binding
GO:0005319	0.602	lipid transporter activity
GO:0050431	0.534	transforming growth factor beta binding
GO:0036041	0.533	long-chain fatty acid binding
GO:0042802	0.310	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0009987	0.985	cellular process
GO:0032501	0.984	multicellular organismal process
GO:0050794	0.979	regulation of cellular process
GO:0051179	0.958	localization
GO:0050896	0.956	response to stimulus
GO:0010876	0.951	lipid localization
GO:0019222	0.892	regulation of metabolic process
GO:0048518	0.889	positive regulation of biological process
GO:0008152	0.877	metabolic process
GO:0006869	0.862	lipid transport
GO:0048522	0.839	positive regulation of cellular process
GO:0071704	0.830	organic substance metabolic process
GO:0080090	0.830	regulation of primary metabolic process
GO:0060255	0.827	regulation of macromolecule metabolic process
GO:0044238	0.826	primary metabolic process
GO:0031323	0.777	regulation of cellular metabolic process
GO:0051716	0.654	cellular response to stimulus
GO:0010468	0.653	regulation of gene expression
GO:0009889	0.618	regulation of biosynthetic process
GO:0044237	0.614	cellular metabolic process
GO:0031326	0.614	regulation of cellular biosynthetic process
GO:0042221	0.609	response to chemical
GO:0010556	0.608	regulation of macromolecule biosynthetic process
GO:0007154	0.561	cell communication
GO:0010033	0.550	response to organic substance
GO:0051171	0.505	regulation of nitrogen compound metabolic process
GO:0023052	0.472	signaling
GO:0006950	0.463	response to stress
GO:0007165	0.462	signal transduction
GO:0006807	0.447	nitrogen compound metabolic process
GO:0009893	0.419	positive regulation of metabolic process
GO:0010604	0.413	positive regulation of macromolecule metabolic process
GO:0048519	0.398	negative regulation of biological process
GO:0019219	0.397	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.395	positive regulation of cellular metabolic process
GO:0006355	0.387	regulation of DNA-templated transcription
GO:0048583	0.380	regulation of response to stimulus
GO:0015711	0.380	organic anion transport
GO:0051173	0.374	positive regulation of nitrogen compound metabolic process
GO:0048523	0.369	negative regulation of cellular process
GO:0046942	0.366	carboxylic acid transport
GO:0009605	0.354	response to external stimulus
GO:0016192	0.352	vesicle-mediated transport
GO:0006629	0.352	lipid metabolic process
GO:0043170	0.348	macromolecule metabolic process
GO:0071310	0.337	cellular response to organic substance
GO:0003008	0.333	system process
GO:0065008	0.321	regulation of biological quality
GO:0009719	0.320	response to endogenous stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.969	membrane
GO:0071944	0.915	cell periphery
GO:0005886	0.896	plasma membrane
GO:0005794	0.885	Golgi apparatus
GO:0070013	0.772	intracellular organelle lumen
GO:0009986	0.541	cell surface
GO:0005634	0.416	nucleus
GO:0032991	0.382	protein-containing complex
GO:0045121	0.327	membrane raft
GO:0031090	0.315	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]