StarFunc result for job id P16860

User Input

>input (134 residues)
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKVLRRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16860	1.000	1.000	5.592E-20	134	1.000	1.000	P16860.pdb.gz	ANFB_HUMAN Natriuretic peptides B OS=Homo sapiens OX=9606 GN=NPPB PE=1 SV=1
2	AFDB:P40753	0.274	0.294	1.985E-2	121	0.299	0.331	P40753.pdb.gz	ANFB_MOUSE Natriuretic peptides B OS=Mus musculus OX=10090 GN=Nppb PE=1 SV=2
3	AFDB:P01161	0.153	0.135	7.709E-2	152	0.313	0.276	P01161.pdb.gz	ANF_RAT Natriuretic peptides A OS=Rattus norvegicus OX=10116 GN=Nppa PE=1 SV=1
4	AFDB:P18908	0.209	0.201	1.271E-1	140	0.269	0.257	P18908.pdb.gz	ANF_CHICK Natriuretic peptides A OS=Gallus gallus OX=9031 GN=NPPA PE=1 SV=2
5	AFDB:F1R3S7	0.206	0.162	2.993E-1	174	0.231	0.178	F1R3S7.pdb.gz	F1R3S7_DANRE Neuromedin U OS=Danio rerio OX=7955 GN=si:rp71-4m17.1 PE=4 SV=1
6	AFDB:P11384	0.234	0.234	4.278E-1	134	0.194	0.194	P11384.pdb.gz	SECR_RAT Secretin OS=Rattus norvegicus OX=10116 GN=Sct PE=1 SV=2
7	AFDB:F1R8L8	0.189	0.197	4.594E-1	129	0.216	0.225	F1R8L8.pdb.gz	F1R8L8_DANRE Natriuretic peptide B OS=Danio rerio OX=7955 GN=si:ch211-215j19.10 PE=3 SV=1
8	AFDB:Q4GYD6	0.219	0.048	1.916	945	0.172	0.024	Q4GYD6.pdb.gz	Q4GYD6_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4420 PE=4 SV=1
9	AFDB:Q9DBP0	0.208	0.069	2.210	697	0.187	0.036	Q9DBP0.pdb.gz	NPT2B_MOUSE Sodium-dependent phosphate transport protein 2B OS=Mus musculus OX=10090 GN=Slc34a2 PE=1 SV=1
10	AFDB:P01257	0.255	0.253	3.158	136	0.209	0.206	P01257.pdb.gz	CALC_RAT Calcitonin OS=Rattus norvegicus OX=10116 GN=Calca PE=1 SV=1
11	PDB:6ylgb	0.273	0.081	3.610	613	0.157	0.034	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
12	PDB:6ahfC	0.182	0.048	3.877	865	0.172	0.027	6ahfC.pdb.gz	Heat shock protein 104 (HSP104) chaperones soluble Tau via a mechanism distinct from its disaggregase activity.
13	PDB:7r5jW0	0.238	0.069	4.473	735	0.119	0.022	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:3j96A	0.196	0.049	4.804	678	0.157	0.031	3j96A.pdb.gz
15	PDB:7edxl	0.126	0.151	5.159	107	0.119	0.150	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:6n8jb	0.218	0.066	5.541	647	0.194	0.040	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
17	PDB:6zheC	0.138	0.037	6.864	705	0.157	0.030	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
18	PDB:7ah91A	0.146	0.105	6.864	223	0.157	0.094	7ah91A.pdb.gz
19	PDB:6u3eA	0.189	0.086	7.918	397	0.112	0.038	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:6wucH	0.222	0.178	7.918	179	0.134	0.101	6wucH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16860	4.50e-94	269	134	1.000	1.000	ANFB_HUMAN Natriuretic peptides B OS=Homo sapiens OX=9606 GN=NPPB PE=1 SV=1
2	P40753	1.33e-10	57.0	121	0.381	0.421	ANFB_MOUSE Natriuretic peptides B OS=Mus musculus OX=10090 GN=Nppb PE=1 SV=2
3	P18908	3.79e-07	48.1	140	0.157	0.150	ANF_CHICK Natriuretic peptides A OS=Gallus gallus OX=9031 GN=NPPA PE=1 SV=2
4	P13205	3.98e-06	45.1	121	0.284	0.314	ANFB_RAT Natriuretic peptides B OS=Rattus norvegicus OX=10116 GN=Nppb PE=1 SV=3
5	F1QVW0	1.75e-04	41.2	139	0.201	0.194	F1QVW0_DANRE Natriuretic peptide A OS=Danio rerio OX=7955 GN=anf PE=1 SV=1
6	Q78AW6	1.93e-04	41.2	148	0.164	0.149	Q78AW6_SALSA Cardiac peptide OS=Salmo salar OX=8030 PE=3 SV=1
7	Q9YGJ1	2.16e-04	40.8	152	0.164	0.145	Q9YGJ1_SALSA Cardiac hormone OS=Salmo salar OX=8030 GN=LOC100136387 PE=2 SV=1
8	F1R8L8	0.002	38.1	129	0.127	0.132	F1R8L8_DANRE Natriuretic peptide B OS=Danio rerio OX=7955 GN=si:ch211-215j19.10 PE=3 SV=1
9	P01160	0.002	38.1	151	0.142	0.126	ANF_HUMAN Natriuretic peptides A OS=Homo sapiens OX=9606 GN=NPPA PE=1 SV=2
10	P82972	0.003	35.4	37	0.119	0.432	VNP_PSEPC Natriuretic peptide PNP OS=Pseudocerastes persicus OX=47769 PE=1 SV=1
11	Q27J49	0.004	37.7	239	0.112	0.063	BNP_LACMU Bradykinin-potentiating and C-type natriuretic peptides OS=Lachesis muta muta OX=8753 PE=1 SV=1
12	D9IX97	0.005	37.4	165	0.104	0.085	VNP_NAJAT Natriuretic peptide Na-NP OS=Naja atra OX=8656 PE=1 SV=1
13	P84715	0.010	36.2	121	0.164	0.182	ANF39_ORNAN C-type natriuretic peptide OS=Ornithorhynchus anatinus OX=9258 PE=1 SV=2
14	B3EWY2	0.014	33.5	32	0.104	0.438	BNPL2_CROOA Natriuretic peptide Coa_NP2 OS=Crotalus oreganus abyssus OX=128077 PE=1 SV=1
15	P05125	0.015	35.8	152	0.104	0.092	ANF_MOUSE Natriuretic peptides A OS=Mus musculus OX=10090 GN=Nppa PE=1 SV=2
16	P01161	0.016	35.8	152	0.104	0.092	ANF_RAT Natriuretic peptides A OS=Rattus norvegicus OX=10116 GN=Nppa PE=1 SV=1
17	B3EWY3	0.026	33.1	32	0.097	0.406	BNPL1_CROOA Natriuretic peptide Coa_NP1 OS=Crotalus oreganus abyssus OX=128077 PE=1 SV=1
18	A0A060XWG0	0.034	34.7	131	0.104	0.107	A0A060XWG0_ONCMY C-type natriuretic peptide 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030908001 PE=3 SV=1
19	Q8AXR3	0.034	34.7	131	0.104	0.107	ANFC1_ONCMY C-type natriuretic peptide 1 OS=Oncorhynchus mykiss OX=8022 GN=cnp-1 PE=2 SV=1
20	Q6LEM5	0.044	35.0	256	0.097	0.051	BNP1_BOTJA Bradykinin-potentiating and C-type natriuretic peptides OS=Bothrops jararaca OX=8724 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00212 ANP	1.6e-10	52.3	Atrial natriuretic peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357669	0.999	Atrial natriuretic peptide receptor 1
2	9606.ENSP00000265074	0.996	Atrial natriuretic peptide receptor 3
3	9606.ENSP00000341083	0.951	Atrial natriuretic peptide receptor 2
4	9606.ENSP00000365663	0.925	Natriuretic peptides A
5	9606.ENSP00000264110	0.903	Cyclic AMP-dependent transcription factor ATF-2
6	9606.ENSP00000265986	0.819	Insulin-degrading enzyme
7	9606.ENSP00000394842	0.787	Grancalcin
8	9606.ENSP00000386041	0.786	Myosin-6
9	9606.ENSP00000347507	0.776	Myosin-7
10	9606.ENSP00000255030	0.775	C-reactive protein
11	9606.ENSP00000341838	0.774	Troponin I, cardiac muscle
12	9606.ENSP00000387760	0.763	Angiotensin-converting enzyme
13	9606.ENSP00000290866	0.760	Angiotensin-converting enzyme
14	9606.ENSP00000387159	0.759	C-type natriuretic peptide
15	9606.ENSP00000236918	0.750	Troponin T, cardiac muscle
16	9606.ENSP00000272190	0.747	Renin
17	9606.ENSP00000368683	0.680	Endothelin-1
18	9606.ENSP00000350132	0.678	Cardiac phospholamban
19	9606.ENSP00000369643	0.646	Gastrin-releasing peptide receptor
20	9606.ENSP00000467176	0.645	Troponin T, slow skeletal muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051427	1.000	hormone receptor binding
GO:0005179	1.000	hormone activity
GO:0008613	0.878	diuretic hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0050789	0.970	regulation of biological process
GO:0050896	0.969	response to stimulus
GO:0032501	0.969	multicellular organismal process
GO:0050794	0.960	regulation of cellular process
GO:0051239	0.944	regulation of multicellular organismal process
GO:0008152	0.939	metabolic process
GO:0071704	0.918	organic substance metabolic process
GO:0009605	0.913	response to external stimulus
GO:0048519	0.906	negative regulation of biological process
GO:0048518	0.906	positive regulation of biological process
GO:0044057	0.904	regulation of system process
GO:0044238	0.902	primary metabolic process
GO:0044237	0.899	cellular metabolic process
GO:0007165	0.899	signal transduction
GO:0008015	0.896	blood circulation
GO:0006952	0.858	defense response
GO:1901564	0.858	organonitrogen compound metabolic process
GO:0051240	0.858	positive regulation of multicellular organismal process
GO:0032879	0.856	regulation of localization
GO:0050793	0.840	regulation of developmental process
GO:0008217	0.840	regulation of blood pressure
GO:0051049	0.835	regulation of transport
GO:1901137	0.827	carbohydrate derivative biosynthetic process
GO:0051050	0.826	positive regulation of transport
GO:0003018	0.811	vascular process in circulatory system
GO:0051241	0.808	negative regulation of multicellular organismal process
GO:0072522	0.796	purine-containing compound biosynthetic process
GO:0044419	0.789	biological process involved in interspecies interaction between organisms
GO:0006955	0.781	immune response
GO:0009260	0.775	ribonucleotide biosynthetic process
GO:0009150	0.737	purine ribonucleotide metabolic process
GO:0006164	0.733	purine nucleotide biosynthetic process
GO:0048522	0.721	positive regulation of cellular process
GO:0007166	0.716	cell surface receptor signaling pathway
GO:0050878	0.700	regulation of body fluid levels
GO:0052652	0.655	cyclic purine nucleotide metabolic process
GO:0009152	0.654	purine ribonucleotide biosynthetic process
GO:0009190	0.649	cyclic nucleotide biosynthetic process
GO:2000026	0.621	regulation of multicellular organismal development
GO:0048583	0.596	regulation of response to stimulus
GO:0051179	0.593	localization
GO:0003014	0.581	renal system process
GO:0002684	0.577	positive regulation of immune system process
GO:0035809	0.565	regulation of urine volume
GO:0032502	0.551	developmental process
GO:0098801	0.550	regulation of renal system process
GO:0098542	0.542	defense response to other organism
GO:0048856	0.535	anatomical structure development
GO:0051046	0.529	regulation of secretion
GO:0044062	0.522	regulation of excretion
GO:0007275	0.453	multicellular organism development
GO:0006959	0.452	humoral immune response
GO:0019222	0.384	regulation of metabolic process
GO:0048523	0.383	negative regulation of cellular process
GO:0007167	0.364	enzyme-linked receptor protein signaling pathway
GO:0042221	0.337	response to chemical
GO:0051093	0.331	negative regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0032991	0.997	protein-containing complex
GO:0005622	0.952	intracellular anatomical structure
GO:0005737	0.942	cytoplasm
GO:0043226	0.925	organelle
GO:0043229	0.896	intracellular organelle
GO:0043227	0.878	membrane-bounded organelle
GO:0043231	0.798	intracellular membrane-bounded organelle
GO:0016020	0.646	membrane
GO:0005615	0.513	extracellular space
GO:0012505	0.471	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]