StarFunc result for job id P16871

User Input

>input (459 residues)
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16871	1.000	1.000	3.903E-77	459	1.000	1.000	P16871.pdb.gz	IL7RA_HUMAN Interleukin-7 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL7R PE=1 SV=3
2	AFDB:P16872	0.510	0.510	1.552E-55	459	0.621	0.621	P16872.pdb.gz	IL7RA_MOUSE Interleukin-7 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il7r PE=1 SV=2
3	AFDB:A0A087X0H5	0.362	0.267	2.677E-16	645	0.163	0.116	A0A087X0H5.pdb.gz	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
4	AFDB:P19941	0.350	0.260	6.891E-16	638	0.157	0.113	P19941.pdb.gz	GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus OX=9986 GN=GHR PE=1 SV=1
5	AFDB:P40189	0.199	0.112	1.488E-12	918	0.176	0.088	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
6	AFDB:F1NDH9	0.296	0.131	1.663E-12	1148	0.179	0.071	F1NDH9.pdb.gz
7	AFDB:Q00560	0.203	0.116	2.196E-12	917	0.159	0.080	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
8	AFDB:P48356	0.179	0.083	4.049E-12	1162	0.120	0.047	P48356.pdb.gz	LEPR_MOUSE Leptin receptor OS=Mus musculus OX=10090 GN=Lepr PE=1 SV=1
9	AFDB:H0ZIF9	0.304	0.135	6.680E-12	1135	0.170	0.069	H0ZIF9.pdb.gz	H0ZIF9_TAEGU Leptin receptor OS=Taeniopygia guttata OX=59729 GN=LEPR PE=2 SV=2
10	AFDB:Q8N6P7	0.261	0.220	8.345E-12	574	0.139	0.111	Q8N6P7.pdb.gz	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
11	PDB:7u7nC	0.320	0.645	1.742E-9	200	0.057	0.130	7u7nC.pdb.gz
12	PDB:5mj3A	0.276	0.395	2.014E-8	302	0.063	0.096	5mj3A.pdb.gz
13	PDB:7z0lB	0.304	0.368	1.194E-7	370	0.070	0.086	7z0lB.pdb.gz
14	PDB:3besR	0.245	0.383	6.701E-7	250	0.044	0.080	3besR.pdb.gz
15	PDB:4rtdA	0.143	0.082	9.679E-6	1122	0.044	0.018	4rtdA.pdb.gz
16	PDB:4ziqA	0.141	0.065	1.023E-5	1450	0.048	0.015	4ziqA.pdb.gz
17	PDB:5a42A	0.170	0.071	1.887E-5	1597	0.046	0.013	5a42A.pdb.gz
18	PDB:6pxvA	0.220	0.133	3.480E-5	823	0.050	0.028	6pxvA.pdb.gz
19	PDB:8dtlA	0.208	0.137	5.430E-5	741	0.054	0.034	8dtlA.pdb.gz
20	PDB:6xi2A	0.187	0.164	8.959E-5	528	0.028	0.025	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16871	0.0	950	459	1.000	1.000	IL7RA_HUMAN Interleukin-7 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL7R PE=1 SV=3
2	P16872	0.0	561	459	0.645	0.645	IL7RA_MOUSE Interleukin-7 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il7r PE=1 SV=2
3	E9QDP8	8.07e-13	72.0	372	0.161	0.199	E9QDP8_DANRE Interleukin 7 receptor OS=Danio rerio OX=7955 GN=il-7ra PE=4 SV=2
4	A8WH87	4.63e-12	69.3	334	0.122	0.168	A8WH87_DANRE Interleukin 7 receptor alpha OS=Danio rerio OX=7955 GN=il-7ra PE=2 SV=1
5	P16471	1.52e-07	56.2	622	0.157	0.116	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
6	Q2VBQ8	1.59e-06	52.8	509	0.109	0.098	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
7	Q2PBN9	3.10e-06	52.0	581	0.089	0.071	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
8	Q9JHX3	8.86e-06	50.4	529	0.107	0.093	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
9	Q00560	1.13e-05	50.4	917	0.133	0.067	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
10	Q28172	1.42e-05	49.7	581	0.087	0.069	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
11	F1N4H8	2.44e-05	48.5	296	0.081	0.125	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2
12	Q9HBE5	4.14e-05	48.1	538	0.068	0.058	IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens OX=9606 GN=IL21R PE=1 SV=1
13	P40189	4.21e-04	45.4	918	0.061	0.031	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
14	Q17RA0	4.44e-04	45.4	918	0.061	0.031	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
15	A0A0A0MTN7	0.001	43.9	549	0.068	0.056	A0A0A0MTN7_HUMAN Interleukin 12 receptor subunit beta 2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=2
16	P40190	0.001	43.9	918	0.083	0.041	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
17	Q04594	0.001	43.5	831	0.153	0.084	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
18	Q90374	0.001	44.3	830	0.089	0.049	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1
19	Q99665	0.001	43.9	862	0.072	0.038	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
20	Q9DE08	0.003	42.7	638	0.057	0.041	Q9DE08_ONCMY Prolactin receptor OS=Oncorhynchus mykiss OX=8022 GN=PRLR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	2.3e-05	36.0	Fibronectin type III domain
2	PF18447 FN3_7	1.3e-37	139.2	Fibronectin type III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263851	0.999	Interleukin-7
2	9606.ENSP00000339804	0.999	Thymic stromal lymphopoietin
3	9606.ENSP00000383641	0.999	Cytokine receptor-like factor 2
4	9606.ENSP00000343204	0.998	Tyrosine-protein kinase JAK1
5	9606.ENSP00000363318	0.998	Cytokine receptor common subunit gamma
6	9606.ENSP00000391676	0.977	Tyrosine-protein kinase JAK3
7	9606.ENSP00000011653	0.947	T-cell surface glycoprotein CD4
8	9606.ENSP00000293328	0.923	Signal transducer and activator of transcription 5B
9	9606.ENSP00000341208	0.923	Signal transducer and activator of transcription 5A
10	9606.ENSP00000226730	0.917	Interleukin-2
11	9606.ENSP00000371067	0.917	Tyrosine-protein kinase JAK2
12	9606.ENSP00000296545	0.908	Interleukin-15
13	9606.ENSP00000216223	0.905	Interleukin-2 receptor subunit beta
14	9606.ENSP00000229135	0.878	Interferon gamma
15	9606.ENSP00000386559	0.875	T-cell surface glycoprotein CD8 alpha chain
16	9606.ENSP00000264657	0.871	Signal transducer and activator of transcription 3
17	9606.ENSP00000412237	0.870	Interleukin-10
18	9606.ENSP00000296871	0.868	Granulocyte-macrophage colony-stimulating factor
19	9606.ENSP00000246657	0.867	C-C chemokine receptor type 7
20	9606.ENSP00000365380	0.867	Forkhead box protein P3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0003823	0.999	antigen binding
GO:0004917	0.922	interleukin-7 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0048583	0.986	regulation of response to stimulus
GO:0002376	0.985	immune system process
GO:0019222	0.979	regulation of metabolic process
GO:0048522	0.979	positive regulation of cellular process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0006955	0.967	immune response
GO:0007165	0.946	signal transduction
GO:0048584	0.919	positive regulation of response to stimulus
GO:0080090	0.916	regulation of primary metabolic process
GO:0051171	0.914	regulation of nitrogen compound metabolic process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0007166	0.904	cell surface receptor signaling pathway
GO:0023051	0.901	regulation of signaling
GO:0010646	0.900	regulation of cell communication
GO:0042127	0.881	regulation of cell population proliferation
GO:0009966	0.878	regulation of signal transduction
GO:0019219	0.872	regulation of nucleobase-containing compound metabolic process
GO:0009967	0.860	positive regulation of signal transduction
GO:0008284	0.752	positive regulation of cell population proliferation
GO:1904892	0.731	regulation of receptor signaling pathway via STAT
GO:0032501	0.626	multicellular organismal process
GO:1904894	0.568	positive regulation of receptor signaling pathway via STAT
GO:0009893	0.510	positive regulation of metabolic process
GO:0010604	0.485	positive regulation of macromolecule metabolic process
GO:0051239	0.464	regulation of multicellular organismal process
GO:0032502	0.448	developmental process
GO:0010468	0.442	regulation of gene expression
GO:0048856	0.432	anatomical structure development
GO:0002682	0.420	regulation of immune system process
GO:0048519	0.408	negative regulation of biological process
GO:0006950	0.406	response to stress
GO:0051240	0.406	positive regulation of multicellular organismal process
GO:0042221	0.386	response to chemical
GO:0048523	0.377	negative regulation of cellular process
GO:0050865	0.363	regulation of cell activation
GO:0031325	0.359	positive regulation of cellular metabolic process
GO:0070887	0.352	cellular response to chemical stimulus
GO:0002694	0.351	regulation of leukocyte activation
GO:0002684	0.347	positive regulation of immune system process
GO:0010033	0.344	response to organic substance
GO:0009605	0.320	response to external stimulus
GO:0030155	0.311	regulation of cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0005622	0.880	intracellular anatomical structure
GO:0043226	0.874	organelle
GO:0043227	0.856	membrane-bounded organelle
GO:0043231	0.841	intracellular membrane-bounded organelle
GO:0005737	0.832	cytoplasm
GO:0031982	0.673	vesicle
GO:0031981	0.661	nuclear lumen
GO:0005654	0.630	nucleoplasm
GO:0030659	0.529	cytoplasmic vesicle membrane
GO:0030136	0.516	clathrin-coated vesicle
GO:0030139	0.507	endocytic vesicle
GO:0030666	0.487	endocytic vesicle membrane
GO:0030662	0.482	coated vesicle membrane
GO:0030669	0.470	clathrin-coated endocytic vesicle membrane
GO:0005829	0.415	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]