StarFunc result for job id P16885

User Input

>input (1265 residues)
MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QLX2	0.625	0.772	0.000	1020	0.402	0.499	F1QLX2.pdb.gz
2	AFDB:P16885	1.000	1.000	0.000	1265	1.000	1.000	P16885.pdb.gz	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
3	AFDB:Q62077	0.831	0.808	0.000	1302	0.492	0.478	Q62077.pdb.gz	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2
4	AFDB:Q9VXH3	0.569	0.582	0.000	1236	0.367	0.375	Q9VXH3.pdb.gz	Q9VXH3_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Drosophila melanogaster OX=7227 GN=sl PE=1 SV=3
5	AFDB:Q22070	0.572	0.539	3.583E-101	1350	0.321	0.301	Q22070.pdb.gz	PLCG_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma plc-3 OS=Caenorhabditis elegans OX=6239 GN=plc-3 PE=2 SV=2
6	AFDB:A2AP18	0.501	0.425	3.621E-59	1501	0.225	0.190	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
7	AFDB:Q4KWH8	0.511	0.386	7.523E-59	1693	0.210	0.157	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
8	AFDB:Q4KWH5	0.522	0.397	1.641E-58	1682	0.218	0.164	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
9	AFDB:O75038	0.497	0.446	4.097E-57	1416	0.221	0.198	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
10	AFDB:F1Q5G9	0.493	0.795	1.128E-55	761	0.206	0.343	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
11	PDB:4gnkB	0.478	0.762	9.698E-42	769	0.181	0.298	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:4gwfA	0.137	0.324	5.676E-12	497	0.062	0.159	4gwfA.pdb.gz
13	PDB:4fl2A	0.108	0.205	3.619E-11	555	0.053	0.121	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:5xzrA	0.140	0.318	1.058E-10	519	0.051	0.125	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
15	PDB:3ps5A	0.085	0.184	1.808E-10	529	0.043	0.104	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
16	PDB:4k2rA	0.079	0.170	2.093E-10	551	0.058	0.134	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:1griA	0.071	0.396	3.408E-10	211	0.044	0.265	1griA.pdb.gz
18	PDB:3qwyA	0.070	0.468	8.831E-8	170	0.028	0.212	3qwyA.pdb.gz
19	PDB:2lqnA	0.065	0.246	3.458E-7	303	0.055	0.231	2lqnA.pdb.gz
20	PDB:2h8hA	0.093	0.221	2.679E-6	445	0.042	0.119	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SDV6	0.0	1247	1291	0.504	0.493	F1SDV6_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Sus scrofa OX=9823 GN=PLCG1 PE=1 SV=5
2	P08487	0.0	1241	1291	0.504	0.494	PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus OX=9913 GN=PLCG1 PE=1 SV=1
3	P10686	0.0	1252	1290	0.504	0.495	PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus OX=10116 GN=Plcg1 PE=1 SV=1
4	P16885	0.0	2647	1265	1.000	1.000	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
5	P19174	0.0	1251	1290	0.504	0.495	PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1
6	P24135	0.0	2529	1265	0.948	0.948	PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus OX=10116 GN=Plcg2 PE=1 SV=1
7	Q22070	0.0	606	1350	0.328	0.307	PLCG_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma plc-3 OS=Caenorhabditis elegans OX=6239 GN=plc-3 PE=2 SV=2
8	Q62077	0.0	1252	1302	0.505	0.491	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2
9	Q804J6	0.0	1246	1312	0.505	0.487	Q804J6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Danio rerio OX=7955 GN=fj46f04 PE=1 SV=1
10	Q8CIH5	0.0	2516	1265	0.942	0.942	PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus OX=10090 GN=Plcg2 PE=1 SV=1
11	Q9VXH3	0.0	795	1236	0.368	0.376	Q9VXH3_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Drosophila melanogaster OX=7227 GN=sl PE=1 SV=3
12	A2AP18	2.53e-63	239	1501	0.122	0.103	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
13	P10688	6.94e-63	231	756	0.111	0.185	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
14	Q8N3E9	8.15e-63	232	789	0.107	0.171	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
15	Q8K2J0	1.18e-62	231	785	0.108	0.173	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
16	P51178	1.72e-62	230	756	0.113	0.189	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
17	Q8R3B1	1.68e-61	228	756	0.109	0.183	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
18	O75038	4.56e-61	232	1416	0.119	0.107	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
19	A0A8I6AGE0	6.45e-61	225	744	0.105	0.179	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
20	D4A978	1.39e-60	225	762	0.105	0.175	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.3e-11	55.3	C2 domain
2	PF09279 EF-hand_like	1.3e+02	14.4	Phosphoinositide-specific phospholipase C, efhand-like
3	PF03009 GDPD	3.8e+02	12.2	Glycerophosphoryl diester phosphodiesterase family
4	PF00169 PH	0.00014	33.7	PH domain
5	PF16457 PH_12	0.078	24.9	Pleckstrin homology domain
6	PF17787 PH_14	1.5	20.1	PH domain
7	PF00388 PI-PLC-X	8.3e-62	218.5	Phosphatidylinositol-specific phospholipase C, X domain
8	PF00387 PI-PLC-Y	8.2e-33	124.5	Phosphatidylinositol-specific phospholipase C, Y domain
9	PF00017 SH2	1e-44	161.8	SH2 domain
10	PF00018 SH3_1	2e-11	54.6	SH3 domain
11	PF07653 SH3_2	0.022	25.9	Variant SH3 domain
12	PF14604 SH3_9	2.2e-07	42.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482457

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000224337	0.999	B-cell linker protein
2	9606.ENSP00000483570	0.999	Tyrosine-protein kinase BTK
3	9606.ENSP00000275493	0.990	Epidermal growth factor receptor
4	9606.ENSP00000378845	0.988	Linker for activation of T cells
5	9606.ENSP00000362680	0.985	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000046794	0.984	Lymphocyte cytosolic protein 2
7	9606.ENSP00000428924	0.983	Tyrosine-protein kinase Lyn
8	9606.ENSP00000354952	0.976	GRB2-associated-binding protein 2
9	9606.ENSP00000364907	0.976	Tyrosine-protein kinase SYK
10	9606.ENSP00000264972	0.975	Tyrosine-protein kinase ZAP-70
11	9606.ENSP00000221972	0.973	B-cell antigen receptor complex-associated protein alpha chain
12	9606.ENSP00000376544	0.969	B-cell antigen receptor complex-associated protein beta chain
13	9606.ENSP00000269571	0.966	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000408695	0.966	Protein kinase C alpha type
15	9606.ENSP00000422168	0.965	SH3 domain-binding protein 2
16	9606.ENSP00000346671	0.963	Tyrosine-protein kinase Fyn
17	9606.ENSP00000305355	0.959	Protein kinase C beta type
18	9606.ENSP00000423602	0.953	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
19	9606.ENSP00000444986	0.953	Tyrosine-protein kinase HCK
20	9606.ENSP00000304236	0.951	Monocyte differentiation antigen CD14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004435	0.999	phosphatidylinositol phospholipase C activity
GO:0019901	0.965	protein kinase binding
GO:1990782	0.960	protein tyrosine kinase binding
GO:0001784	0.915	phosphotyrosine residue binding
GO:0097110	0.847	scaffold protein binding
GO:0005102	0.773	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.979	positive regulation of cellular process
GO:0007165	0.979	signal transduction
GO:0048583	0.969	regulation of response to stimulus
GO:0051282	0.961	regulation of sequestering of calcium ion
GO:0042221	0.960	response to chemical
GO:0048584	0.954	positive regulation of response to stimulus
GO:0019222	0.952	regulation of metabolic process
GO:0002684	0.948	positive regulation of immune system process
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0050851	0.936	antigen receptor-mediated signaling pathway
GO:0009893	0.935	positive regulation of metabolic process
GO:0010628	0.933	positive regulation of gene expression
GO:0035556	0.926	intracellular signal transduction
GO:0044237	0.918	cellular metabolic process
GO:0001775	0.917	cell activation
GO:0032103	0.917	positive regulation of response to external stimulus
GO:0006816	0.917	calcium ion transport
GO:0051130	0.916	positive regulation of cellular component organization
GO:0051283	0.905	negative regulation of sequestering of calcium ion
GO:0080090	0.901	regulation of primary metabolic process
GO:0002252	0.897	immune effector process
GO:0031323	0.894	regulation of cellular metabolic process
GO:0002833	0.894	positive regulation of response to biotic stimulus
GO:0051049	0.886	regulation of transport
GO:0050853	0.882	B cell receptor signaling pathway
GO:0010033	0.881	response to organic substance
GO:0071704	0.876	organic substance metabolic process
GO:1901700	0.874	response to oxygen-containing compound
GO:0044238	0.872	primary metabolic process
GO:0051050	0.869	positive regulation of transport
GO:0030100	0.854	regulation of endocytosis
GO:0051209	0.853	release of sequestered calcium ion into cytosol
GO:1902074	0.847	response to salt
GO:0044093	0.845	positive regulation of molecular function
GO:0048856	0.842	anatomical structure development
GO:0051171	0.831	regulation of nitrogen compound metabolic process
GO:0009889	0.827	regulation of biosynthetic process
GO:0010038	0.820	response to metal ion
GO:0006955	0.816	immune response
GO:0051090	0.809	regulation of DNA-binding transcription factor activity
GO:0051091	0.801	positive regulation of DNA-binding transcription factor activity
GO:0048468	0.798	cell development
GO:0031347	0.795	regulation of defense response
GO:0065008	0.787	regulation of biological quality
GO:0051924	0.787	regulation of calcium ion transport
GO:0009967	0.773	positive regulation of signal transduction
GO:1902531	0.757	regulation of intracellular signal transduction
GO:0006796	0.751	phosphate-containing compound metabolic process
GO:0019637	0.710	organophosphate metabolic process
GO:0031325	0.704	positive regulation of cellular metabolic process
GO:0051240	0.692	positive regulation of multicellular organismal process
GO:0006950	0.688	response to stress
GO:0070887	0.681	cellular response to chemical stimulus
GO:0010243	0.672	response to organonitrogen compound
GO:0002758	0.646	innate immune response-activating signaling pathway
GO:0019722	0.629	calcium-mediated signaling
GO:0002220	0.602	innate immune response activating cell surface receptor signaling pathway
GO:0009605	0.589	response to external stimulus
GO:0009607	0.581	response to biotic stimulus
GO:1901701	0.581	cellular response to oxygen-containing compound
GO:0044419	0.574	biological process involved in interspecies interaction between organisms
GO:0071310	0.548	cellular response to organic substance
GO:0045807	0.512	positive regulation of endocytosis
GO:0030097	0.467	hemopoiesis
GO:0002521	0.428	leukocyte differentiation
GO:0051707	0.414	response to other organism
GO:0009617	0.366	response to bacterium
GO:0046486	0.346	glycerolipid metabolic process
GO:1902533	0.330	positive regulation of intracellular signal transduction
GO:0006650	0.325	glycerophospholipid metabolic process
GO:0006807	0.306	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0005829	0.982	cytosol
GO:0043226	0.834	organelle
GO:0043227	0.820	membrane-bounded organelle
GO:0043229	0.793	intracellular organelle
GO:0043231	0.773	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.999	phosphoinositide phospholipase C.

[back to server]