StarFunc result for job id P16930

User Input

>input (419 residues)
MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQD
VFNQPTLNSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPAT
IGDYTDFYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQM
KPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQ
KWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYTFDINLS
VNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
SMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16930	1.000	1.000	6.645E-100	419	1.000	1.000	P16930.pdb.gz	FAAA_HUMAN Fumarylacetoacetase OS=Homo sapiens OX=9606 GN=FAH PE=1 SV=2
2	AFDB:P25093	0.999	0.999	2.442E-93	419	0.885	0.885	P25093.pdb.gz	FAAA_RAT Fumarylacetoacetase OS=Rattus norvegicus OX=10116 GN=Fah PE=1 SV=1
3	PDB:1hyoB	0.992	0.992	1.683E-90	419	0.888	0.888	1hyoB.pdb.gz	Mechanistic inferences from the crystal structure of fumarylacetoacetate hydrolase with a bound phosphorus-based inhibitor.
4	AFDB:Q8RW90	0.977	0.972	1.659E-71	421	0.575	0.572	Q8RW90.pdb.gz	FAH_ARATH Fumarylacetoacetase OS=Arabidopsis thaliana OX=3702 GN=FAH PE=1 SV=1
5	AFDB:Q00770	0.971	0.944	3.827E-63	431	0.482	0.469	Q00770.pdb.gz	FAAA_EMENI Fumarylacetoacetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=fahA PE=1 SV=3
6	AFDB:O86346	0.615	0.411	2.086E-21	644	0.191	0.124	O86346.pdb.gz	O86346_MYCTU Possible bifunctional enzyme: 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase) + cyclase/dehydrase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0939 PE=1 SV=1
7	AFDB:Q96GK7	0.580	0.756	4.187E-20	314	0.177	0.236	Q96GK7.pdb.gz	FAH2A_HUMAN Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1
8	AFDB:Q3TC72	0.570	0.746	1.309E-19	313	0.200	0.268	Q3TC72.pdb.gz	FAHD2_MOUSE Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Mus musculus OX=10090 GN=Fahd2 PE=1 SV=1
9	AFDB:G8BL05	0.450	0.625	5.760E-13	294	0.110	0.156	G8BL05.pdb.gz	G8BL05_CANPC Fumarylacetoacetase-like C-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=FPH1 PE=3 SV=1
10	PDB:6sbiA	0.409	0.760	1.556E-11	216	0.126	0.245	6sbiA.pdb.gz	Structural and functional comparison of fumarylacetoacetate domain containing protein 1 in human and mouse.
11	AFDB:Q6P587	0.421	0.755	1.561E-11	224	0.122	0.228	Q6P587.pdb.gz	FAHD1_HUMAN Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2
12	PDB:6fogA	0.411	0.757	1.754E-11	218	0.122	0.234	6fogA.pdb.gz	Structural basis for the bi-functionality of human oxaloacetate decarboxylase FAHD1.
13	AFDB:P53889	0.431	0.667	2.106E-11	259	0.107	0.174	P53889.pdb.gz	FMP41_YEAST Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP41 PE=1 SV=1
14	PDB:1nkqA	0.410	0.664	3.826E-11	247	0.098	0.166	1nkqA.pdb.gz	Crtystal Structure of Yeast Hypothetical Protein YNQ8_YEAST
15	PDB:3bqbX	0.452	0.622	2.770E-10	291	0.143	0.206	3bqbX.pdb.gz	Structural insight into substrate binding and catalysis of a novel 2-keto-3-deoxy-D-arabinonate dehydratase illustrates common mechanistic features of the FAH superfamily
16	PDB:2wqtA	0.349	0.522	5.851E-6	262	0.086	0.137	2wqtA.pdb.gz
17	PDB:3f1sA	0.098	0.102	8.121E-2	385	0.074	0.081	3f1sA.pdb.gz
18	PDB:8dtlA	0.096	0.060	2.252E-1	741	0.074	0.042	8dtlA.pdb.gz
19	PDB:5j3nA	0.108	0.115	3.427E-1	386	0.041	0.044	5j3nA.pdb.gz
20	PDB:6pxvA	0.086	0.050	4.103E-1	823	0.076	0.039	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16930	0.0	872	419	1.000	1.000	FAAA_HUMAN Fumarylacetoacetase OS=Homo sapiens OX=9606 GN=FAH PE=1 SV=2
2	P25093	0.0	784	419	0.885	0.885	FAAA_RAT Fumarylacetoacetase OS=Rattus norvegicus OX=10116 GN=Fah PE=1 SV=1
3	P35505	0.0	791	419	0.888	0.888	FAAA_MOUSE Fumarylacetoacetase OS=Mus musculus OX=10090 GN=Fah PE=1 SV=2
4	Q8RW90	3.07e-177	503	421	0.578	0.575	FAH_ARATH Fumarylacetoacetase OS=Arabidopsis thaliana OX=3702 GN=FAH PE=1 SV=1
5	Q00770	6.47e-127	375	431	0.487	0.473	FAAA_EMENI Fumarylacetoacetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=fahA PE=1 SV=3
6	O86346	1.92e-10	65.1	644	0.136	0.089	O86346_MYCTU Possible bifunctional enzyme: 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase) + cyclase/dehydrase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0939 PE=1 SV=1
7	P34673	0.011	39.3	214	0.134	0.262	FAHD1_CAEEL Fumarylacetoacetate hydrolase domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fahd-1 PE=3 SV=1
8	Q3TC72	0.13	36.6	313	0.110	0.147	FAHD2_MOUSE Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Mus musculus OX=10090 GN=Fahd2 PE=1 SV=1
9	P08003	1.5	33.5	638	0.045	0.030	PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus OX=10090 GN=Pdia4 PE=1 SV=3
10	A0A1D8PEQ9	4.9	32.0	961	0.045	0.020	A0A1D8PEQ9_CANAL Vacuolar protein sorting-associated protein 41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS41 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01557 FAA_hydrolase	1.1e-44	164.5	Fumarylacetoacetate (FAA) hydrolase family
2	PF09298 FAA_hydrolase_N	1.9e-30	116.5	Fumarylacetoacetase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216465	0.986	Maleylacetoacetate isomerase
2	9606.ENSP00000372112	0.982	Acylpyruvase FAHD1, mitochondrial
3	9606.ENSP00000289004	0.980	4-hydroxyphenylpyruvate dioxygenase
4	9606.ENSP00000283871	0.972	Homogentisate 1,2-dioxygenase
5	9606.ENSP00000355518	0.852	Fumarate hydratase, mitochondrial
6	9606.ENSP00000264932	0.843	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
7	9606.ENSP00000296412	0.822	Alcohol dehydrogenase class-3
8	9606.ENSP00000286621	0.820	Adenosine kinase
9	9606.ENSP00000348234	0.820	Tyrosine aminotransferase
10	9606.ENSP00000364649	0.820	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
11	9606.ENSP00000356953	0.818	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
12	9606.ENSP00000364699	0.814	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
13	9606.ENSP00000283646	0.799	Ribose 5-phosphate isomerase A
14	9606.ENSP00000348395	0.796	Probable aminopeptidase NPEPL1
15	9606.ENSP00000379865	0.794	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
16	9606.ENSP00000335060	0.790	4-hydroxyphenylpyruvate dioxygenase-like protein
17	9606.ENSP00000267814	0.780	Sorbitol dehydrogenase
18	9606.ENSP00000381607	0.754	Glutathione S-transferase P
19	9606.ENSP00000330032	0.732	Uridine phosphorylase 1
20	9606.ENSP00000474090	0.732	Uridine phosphorylase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004334	1.000	fumarylacetoacetase activity
GO:0005488	0.969	binding
GO:0005515	0.941	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0044281	0.989	small molecule metabolic process
GO:1901564	0.968	organonitrogen compound metabolic process
GO:0006725	0.906	cellular aromatic compound metabolic process
GO:0019752	0.897	carboxylic acid metabolic process
GO:1901360	0.867	organic cyclic compound metabolic process
GO:0009056	0.752	catabolic process
GO:1901565	0.720	organonitrogen compound catabolic process
GO:1901605	0.720	alpha-amino acid metabolic process
GO:0044248	0.709	cellular catabolic process
GO:0044282	0.706	small molecule catabolic process
GO:0046395	0.697	carboxylic acid catabolic process
GO:1901606	0.685	alpha-amino acid catabolic process
GO:0009072	0.469	aromatic amino acid metabolic process
GO:1901361	0.441	organic cyclic compound catabolic process
GO:0019439	0.403	aromatic compound catabolic process
GO:0009074	0.332	aromatic amino acid family catabolic process
GO:0006570	0.319	tyrosine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0005576	0.998	extracellular region
GO:0070062	0.988	extracellular exosome
GO:0043231	0.834	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10244	1.000	4-fumarylacetoacetate + H2O = acetoacetate + fumarate + H(+)
EC:3.7.1.2	1.000	fumarylacetoacetase.

[back to server]