StarFunc result for job id P16949

User Input

>input (149 residues)
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHIEEVRKNKESKDPADETEAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13668	0.985	0.985	9.375E-18	149	0.993	0.993	P13668.pdb.gz	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2
2	AFDB:P21818	0.856	0.717	8.984E-11	179	0.664	0.553	P21818.pdb.gz	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
3	AFDB:Q9H169	0.737	0.599	4.367E-10	189	0.664	0.524	Q9H169.pdb.gz	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
4	AFDB:Q4VBT7	0.814	0.683	4.982E-10	180	0.584	0.483	Q4VBT7.pdb.gz	Q4VBT7_DANRE Stathmin OS=Danio rerio OX=7955 GN=scg10 PE=2 SV=1
5	AFDB:E7FE68	0.813	0.683	8.439E-10	180	0.597	0.494	E7FE68.pdb.gz	E7FE68_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:92905 PE=3 SV=1
6	AFDB:Q5RIC7	0.754	0.614	9.628E-10	188	0.644	0.511	Q5RIC7.pdb.gz	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
7	AFDB:O70166	0.841	0.703	1.253E-9	180	0.624	0.517	O70166.pdb.gz	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
8	AFDB:Q5XIY0	0.526	0.457	2.137E-7	175	0.463	0.394	Q5XIY0.pdb.gz
9	AFDB:Q8IPK0	0.654	0.337	2.630E-4	302	0.329	0.162	Q8IPK0.pdb.gz	Q8IPK0_DROME Stathmin, isoform B OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=1
10	AFDB:M9NEA1	0.618	0.258	5.083E-4	381	0.322	0.126	M9NEA1.pdb.gz	M9NEA1_DROME Stathmin, isoform D OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=1
11	PDB:7odrO	0.147	0.143	4.235	154	0.081	0.078	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
12	PDB:6gg3E	0.121	0.041	4.831	481	0.060	0.019	6gg3E.pdb.gz	An allostatic mechanism for M2 pyruvate kinase as an amino-acid sensor.
13	PDB:7qdsA	0.150	0.146	5.887	155	0.107	0.103	7qdsA.pdb.gz
14	PDB:3jcjf	0.093	0.032	7.173	509	0.027	0.008	3jcjf.pdb.gz	Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
15	PDB:2jkfA	0.098	0.087	7.662	170	0.020	0.018	2jkfA.pdb.gz
16	PDB:6faiG	0.309	0.208	7.662	232	0.107	0.069	6faiG.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
17	PDB:2ehjA	0.096	0.075	8.741	208	0.013	0.010	2ehjA.pdb.gz
18	PDB:2g4cA	0.112	0.048	9.336	397	0.020	0.008	2g4cA.pdb.gz
19	PDB:5e38B	0.096	0.084	9.336	175	0.000	0.000	5e38B.pdb.gz
20	PDB:7dl2B	0.114	0.022	9.336	1042	0.094	0.013	7dl2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16949	5.81e-100	285	149	1.000	1.000	STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3
2	P13668	9.84e-100	284	149	0.993	0.993	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2
3	Q96CE4	2.05e-99	283	149	0.993	0.993	Q96CE4_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=1
4	P54227	2.32e-99	283	149	0.987	0.987	STMN1_MOUSE Stathmin OS=Mus musculus OX=10090 GN=Stmn1 PE=1 SV=2
5	P31395	2.31e-92	266	148	0.919	0.926	STMN1_CHICK Stathmin OS=Gallus gallus OX=9031 GN=STMN1 PE=1 SV=1
6	Q9H169	2.03e-60	186	189	0.678	0.534	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
7	P55821	2.14e-58	181	179	0.671	0.559	STMN2_MOUSE Stathmin-2 OS=Mus musculus OX=10090 GN=Stmn2 PE=1 SV=1
8	Q93045	2.14e-58	181	179	0.671	0.559	STMN2_HUMAN Stathmin-2 OS=Homo sapiens OX=9606 GN=STMN2 PE=1 SV=3
9	P21818	1.23e-57	179	179	0.664	0.553	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
10	Q6PBU3	1.10e-55	174	188	0.658	0.521	Q6PBU3_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:73243 PE=2 SV=1
11	Q5RIC7	1.15e-55	174	188	0.658	0.521	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
12	Q9NZ72	7.59e-54	169	180	0.631	0.522	STMN3_HUMAN Stathmin-3 OS=Homo sapiens OX=9606 GN=STMN3 PE=1 SV=3
13	O70166	1.02e-53	169	180	0.624	0.517	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
14	Q9JHU6	3.17e-53	168	180	0.624	0.517	STMN3_RAT Stathmin-3 OS=Rattus norvegicus OX=10116 GN=Stmn3 PE=1 SV=1
15	A0A0J9YW36	8.00e-53	169	239	0.631	0.393	A0A0J9YW36_HUMAN Stathmin 3 (Fragment) OS=Homo sapiens OX=9606 GN=STMN3 PE=1 SV=1
16	E7FE68	8.49e-52	164	180	0.597	0.494	E7FE68_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:92905 PE=3 SV=1
17	Q4VBT7	9.16e-52	164	180	0.584	0.483	Q4VBT7_DANRE Stathmin OS=Danio rerio OX=7955 GN=scg10 PE=2 SV=1
18	Q9GQR4	4.46e-12	62.4	174	0.315	0.270	Q9GQR4_DROME Stathmin (Fragment) OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1
19	Q9VMH3	1.18e-11	62.4	250	0.322	0.192	Q9VMH3_DROME LD04103p OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=2
20	Q9GQR6	1.25e-11	62.0	234	0.315	0.201	Q9GQR6_DROME Stathmin-1 OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06479 Ribonuc_2-5A	1.6e+02	13.8	Ribonuclease 2-5A
2	PF00836 Stathmin	3.1e-52	187.6	Stathmin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008564176.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008564848.1	0.947	Cyclin-dependent kinase 1
2	482537.XP_008582817.1	0.918	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 22 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008573021.1	0.914	Mitogen-activated protein kinase 1
4	482537.XP_008573732.1	0.871	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008581196.1	0.781	Rac GTPase-activating protein 1
6	482537.XP_008579928.1	0.761	Aurora kinase B
7	482537.XP_008580941.1	0.758	Tubulin alpha-1C chain
8	482537.XP_008585678.1	0.758	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 257 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008569566.1	0.747	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 5 Proteins, and 42% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008585404.1	0.735	G2/mitotic-specific cyclin-B1
11	482537.XP_008576960.1	0.729	Signal transducer and activator of transcription 3-like
12	482537.XP_008576963.1	0.729	Signal transducer and activator of transcription 3-like
13	482537.XP_008573544.1	0.701	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 45 mRNAs, 236 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008563925.1	0.666	Tubulin beta chain
15	482537.XP_008574041.1	0.666	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 229 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
16	482537.XP_008587231.1	0.666	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 46 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
17	482537.XP_008561381.1	0.657	Tubulin alpha-3 chain
18	482537.XP_008575749.1	0.657	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
19	482537.XP_008581337.1	0.657	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
20	482537.XP_008591570.1	0.655	Tubulin beta-1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0048523	0.962	negative regulation of cellular process
GO:1902903	0.948	regulation of supramolecular fiber organization
GO:0031110	0.939	regulation of microtubule polymerization or depolymerization
GO:0048856	0.910	anatomical structure development
GO:0032501	0.907	multicellular organismal process
GO:0071840	0.887	cellular component organization or biogenesis
GO:0032271	0.885	regulation of protein polymerization
GO:0031113	0.849	regulation of microtubule polymerization
GO:0016043	0.827	cellular component organization
GO:0051129	0.809	negative regulation of cellular component organization
GO:0007017	0.750	microtubule-based process
GO:0051301	0.742	cell division
GO:0032272	0.741	negative regulation of protein polymerization
GO:0007275	0.724	multicellular organism development
GO:0031111	0.724	negative regulation of microtubule polymerization or depolymerization
GO:0006996	0.723	organelle organization
GO:0050896	0.720	response to stimulus
GO:0022402	0.705	cell cycle process
GO:0007010	0.697	cytoskeleton organization
GO:0000226	0.666	microtubule cytoskeleton organization
GO:1902904	0.648	negative regulation of supramolecular fiber organization
GO:0051716	0.609	cellular response to stimulus
GO:0051261	0.597	protein depolymerization
GO:0007154	0.582	cell communication
GO:0023052	0.577	signaling
GO:0007165	0.570	signal transduction
GO:0031109	0.493	microtubule polymerization or depolymerization
GO:0007019	0.478	microtubule depolymerization
GO:0048731	0.451	system development
GO:0010564	0.448	regulation of cell cycle process
GO:0007399	0.429	nervous system development
GO:0048518	0.393	positive regulation of biological process
GO:0048522	0.384	positive regulation of cellular process
GO:0048513	0.352	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043227	0.962	membrane-bounded organelle
GO:0016020	0.960	membrane
GO:0043229	0.529	intracellular organelle
GO:0005576	0.442	extracellular region
GO:0031982	0.432	vesicle
GO:0043231	0.410	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]