StarFunc result for job id P16989

User Input

>input (372 residues)
MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDA
APAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQ
TAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRG
YYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPY
HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR
PAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTE
NPAPPTQQSSAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAQ1	0.337	0.337	2.814E-49	372	1.000	1.000	A0A024RAQ1.pdb.gz
2	AFDB:O62213	0.279	0.482	8.383E-18	208	0.255	0.457	O62213.pdb.gz	O62213_CAEEL CSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cey-1 PE=1 SV=1
3	PDB:2l15A	0.179	0.886	7.860E-7	70	0.081	0.429	2l15A.pdb.gz
4	PDB:2lxjA	0.160	0.820	3.011E-6	66	0.086	0.485	2lxjA.pdb.gz
5	PDB:3aqqA	0.149	0.515	1.035E-3	99	0.043	0.162	3aqqA.pdb.gz
6	PDB:1zeqX	0.151	0.539	6.707E-3	84	0.030	0.131	1zeqX.pdb.gz
7	PDB:6d6qG	0.163	0.244	2.157E-2	237	0.027	0.042	6d6qG.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
8	PDB:6d6qH	0.146	0.184	3.441E-2	289	0.030	0.038	6d6qH.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
9	PDB:6w6wC	0.120	0.136	3.648E-2	323	0.030	0.034	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
10	PDB:7ajtEH	0.148	0.220	4.099E-2	237	0.040	0.063	7ajtEH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	PDB:1q8kA	0.163	0.196	4.884E-2	300	0.019	0.023	1q8kA.pdb.gz
12	AFDB:Q08AM8	0.079	0.045	8.447E-2	729	0.164	0.084	Q08AM8.pdb.gz	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
13	PDB:8d0bB	0.120	0.123	9.844E-2	362	0.032	0.033	8d0bB.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
14	AFDB:Q498M5	0.082	0.051	1.131E-1	735	0.185	0.094	Q498M5.pdb.gz	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
15	AFDB:Q93ZL5	0.129	0.110	1.169	457	0.145	0.118	Q93ZL5.pdb.gz	CDF2_ARATH Cyclic dof factor 2 OS=Arabidopsis thaliana OX=3702 GN=CDF2 PE=1 SV=2
16	AFDB:Q9W2F0	0.088	0.044	1.240	835	0.142	0.063	Q9W2F0.pdb.gz	Q9W2F0_DROME LD45439p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10321 PE=2 SV=1
17	AFDB:F4JP43	0.062	0.021	1.393	2037	0.177	0.032	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
18	AFDB:Q7T2T7	0.080	0.062	1.393	524	0.129	0.092	Q7T2T7.pdb.gz	Q7T2T7_DANRE Methyl-CpG-binding protein 2 OS=Danio rerio OX=7955 GN=wu:fk96a04 PE=2 SV=2
19	AFDB:Q9S9P0	0.076	0.037	1.477	990	0.142	0.054	Q9S9P0.pdb.gz	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
20	AFDB:Q8BIF2	0.093	0.092	1.978	374	0.169	0.168	Q8BIF2.pdb.gz	RFOX3_MOUSE RNA binding protein fox-1 homolog 3 OS=Mus musculus OX=10090 GN=Rbfox3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16989	0.0	734	372	1.000	1.000	YBOX3_HUMAN Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4
2	Q9JKB3	2.82e-168	476	361	0.758	0.781	YBOX3_MOUSE Y-box-binding protein 3 OS=Mus musculus OX=10090 GN=Ybx3 PE=1 SV=2
3	Q62764	6.37e-160	454	361	0.769	0.792	YBOX3_RAT Y-box-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ybx3 PE=1 SV=1
4	Q9N1Q2	3.18e-142	410	372	0.903	0.903	Q9N1Q2_CANLF Y-box protein ZONAB-B OS=Canis lupus familiaris OX=9615 GN=ZONAB PE=1 SV=1
5	B5DE31	1.63e-57	191	310	0.376	0.452	YBOX1_DANRE Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1
6	P67809	8.77e-56	187	324	0.237	0.272	YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3
7	P62960	9.96e-56	187	322	0.237	0.273	YBOX1_MOUSE Y-box-binding protein 1 OS=Mus musculus OX=10090 GN=Ybx1 PE=1 SV=3
8	P62961	9.96e-56	187	322	0.237	0.273	YBOX1_RAT Y-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ybx1 PE=2 SV=3
9	Q9Y2T7	3.26e-54	184	364	0.255	0.261	YBOX2_HUMAN Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2
10	D4A3P0	4.34e-52	179	359	0.242	0.251	D4A3P0_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=1 SV=1
11	Q9Z2C8	2.87e-51	176	360	0.239	0.247	YBOX2_MOUSE Y-box-binding protein 2 OS=Mus musculus OX=10090 GN=Ybx2 PE=1 SV=1
12	P45441	4.92e-51	175	324	0.215	0.247	YBX2B_XENLA Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2
13	P21574	9.22e-51	174	336	0.223	0.247	YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3
14	A0A8I5ZJP8	1.97e-50	172	282	0.215	0.284	A0A8I5ZJP8_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=4 SV=1
15	Q95RE4	5.49e-45	160	352	0.215	0.227	Q95RE4_DROME LD37574p OS=Drosophila melanogaster OX=7227 GN=yps PE=1 SV=1
16	M9NFR5	9.91e-45	159	340	0.215	0.235	M9NFR5_DROME Ypsilon schachtel, isoform B OS=Drosophila melanogaster OX=7227 GN=yps PE=1 SV=1
17	O62213	3.81e-44	153	208	0.191	0.341	O62213_CAEEL CSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cey-1 PE=1 SV=1
18	O46173	3.00e-43	155	359	0.215	0.223	O46173_DROME Y-box protein OS=Drosophila melanogaster OX=7227 GN=yps PE=2 SV=1
19	H0Y449	4.84e-33	128	374	0.164	0.163	H0Y449_HUMAN Y-box binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=1
20	C9J5V9	1.11e-27	110	216	0.156	0.269	C9J5V9_HUMAN Y-box binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00313 CSD	1.1e-22	91.0	'Cold-shock' DNA-binding domain
2	PF05297 Herpes_LMP1	51	14.5	Herpesvirus latent membrane protein 1 (LMP1)
3	PF08206 OB_RNB	60	14.7	Ribonuclease B OB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228251

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281537	0.998	Tight junction protein ZO-1
2	9606.ENSP00000257904	0.986	Cyclin-dependent kinase 4
3	9606.ENSP00000245934	0.973	Symplekin
4	9606.ENSP00000005257	0.968	Ras-related protein Ral-A
5	9606.ENSP00000052754	0.948	Decorin
6	9606.ENSP00000227507	0.881	G1/S-specific cyclin-D1
7	9606.ENSP00000354837	0.766	Rho guanine nucleotide exchange factor 2
8	9606.ENSP00000438262	0.741	Tight junction protein ZO-2
9	9606.ENSP00000272519	0.667	Ras-related protein Ral-B
10	9606.ENSP00000354553	0.627	Glycosylated lysosomal membrane protein
11	9606.ENSP00000311677	0.589	Nuclear inhibitor of protein phosphatase 1
12	9606.ENSP00000353910	0.561	Alpha-(1,6)-fucosyltransferase
13	9606.ENSP00000361626	0.556	Nuclease-sensitive element-binding protein 1
14	9606.ENSP00000217244	0.546	Casein kinase II subunit alpha
15	9606.ENSP00000400646	0.541	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
16	9606.ENSP00000347379	0.538	Occludin
17	9606.ENSP00000353238	0.537	Leukosialin
18	9606.ENSP00000465419	0.525	Tight junction protein ZO-3
19	9606.ENSP00000422626	0.515	La-related protein 7
20	9606.ENSP00000271636	0.513	Cingulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	0.853	DNA binding
GO:0003729	0.472	mRNA binding
GO:0003697	0.373	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0009987	0.987	cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0010468	0.963	regulation of gene expression
GO:0048523	0.960	negative regulation of cellular process
GO:0051252	0.960	regulation of RNA metabolic process
GO:0010608	0.949	post-transcriptional regulation of gene expression
GO:0051172	0.948	negative regulation of nitrogen compound metabolic process
GO:0009893	0.945	positive regulation of metabolic process
GO:0010604	0.944	positive regulation of macromolecule metabolic process
GO:0010605	0.942	negative regulation of macromolecule metabolic process
GO:0031324	0.940	negative regulation of cellular metabolic process
GO:1903311	0.934	regulation of mRNA metabolic process
GO:0031329	0.921	regulation of cellular catabolic process
GO:0010628	0.911	positive regulation of gene expression
GO:0061013	0.910	regulation of mRNA catabolic process
GO:0043488	0.895	regulation of mRNA stability
GO:0009895	0.884	negative regulation of catabolic process
GO:0051253	0.850	negative regulation of RNA metabolic process
GO:0048255	0.831	mRNA stabilization
GO:0010556	0.616	regulation of macromolecule biosynthetic process
GO:0050896	0.611	response to stimulus
GO:0051716	0.604	cellular response to stimulus
GO:0031326	0.589	regulation of cellular biosynthetic process
GO:0048522	0.496	positive regulation of cellular process
GO:0048583	0.409	regulation of response to stimulus
GO:0042221	0.407	response to chemical
GO:0042981	0.342	regulation of apoptotic process
GO:0071704	0.324	organic substance metabolic process
GO:0051246	0.322	regulation of protein metabolic process
GO:0006950	0.301	response to stress
GO:0009966	0.301	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0005634	0.862	nucleus
GO:0070013	0.482	intracellular organelle lumen
GO:0016020	0.475	membrane
GO:0031981	0.471	nuclear lumen
GO:0032991	0.416	protein-containing complex
GO:0005654	0.393	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]