StarFunc result for job id P17010

User Input

>input (805 residues)
MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDPD
SVVIQDVIEDVVIEDVQCPDIMEEADVSETVIIPEQVLDSDVTEEVSLAHCTVPDDVLAS
DITSASMSMPEHVLTGDSIHVSDVGHVGHVGHVEHVVHDSVVEAEIVTDPLTTDVVSEEV
LVADCASEAVIDANGIPVDQQDDDKGNCEDYLMISLDDAGKIEHDGSSGMTMDTESEIDP
CKVDGTCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVY
MTVNDSQPEDEDLNVAEIADEVYMEVIVGEEDAAAAAAAAAVHEQQMDDNEIKTFMPIAW
AAAYGNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGH
PLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKL
TSKAEKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLA
VHSKNFPHICVECGKGFRHPSELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHS
KEMPFKCDICLLTFSDTKEVQQHALIHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDY
PHKCDMCDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFR
CKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEY
CKKGFRRPSEKNQHIMRHHKEVGLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RC04	0.423	0.423	0.000	805	1.000	1.000	A0A024RC04.pdb.gz
2	AFDB:E9PEP7	0.363	0.385	0.000	755	0.935	0.997	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
3	AFDB:P20662	0.338	0.349	1.088E-86	777	0.687	0.712	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
4	AFDB:A7Y7X5	0.349	0.367	1.098E-72	761	0.553	0.585	A7Y7X5.pdb.gz	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
5	AFDB:Q9Y462	0.308	0.323	4.477E-71	761	0.545	0.577	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
6	AFDB:P57071	0.134	0.077	2.479E-23	1507	0.211	0.113	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
7	AFDB:Q9HCE3	0.076	0.056	4.627E-15	1301	0.200	0.124	Q9HCE3.pdb.gz	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
8	AFDB:P47043	0.138	0.129	2.526E-14	880	0.175	0.160	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
9	AFDB:Q92610	0.081	0.065	2.584E-13	1267	0.181	0.115	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
10	AFDB:Q9VI93	0.139	0.123	4.013E-13	946	0.140	0.119	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
11	PDB:3w5kB	0.074	0.322	2.894E-4	110	0.047	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6f40P	0.056	0.113	3.744E-1	246	0.030	0.098	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
13	PDB:6fyxm	0.028	0.123	5.459E-1	147	0.015	0.082	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
14	PDB:6ydhA	0.031	0.201	5.813E-1	62	0.014	0.177	6ydhA.pdb.gz
15	PDB:4kblA	0.052	0.091	7.020E-1	395	0.042	0.086	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
16	PDB:3euhC	0.046	0.107	7.475E-1	206	0.024	0.092	3euhC.pdb.gz
17	PDB:5apny	0.038	0.114	7.960E-1	211	0.041	0.156	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:7z0oD	0.056	0.109	1.024	296	0.047	0.128	7z0oD.pdb.gz	Mechanism of RNA polymerase I selection by transcription factor UAF.
19	PDB:5fj9O	0.070	0.089	1.316	528	0.055	0.083	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
20	PDB:5dkaA	0.038	0.222	1.401	96	0.022	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7Y7X5	0.0	841	761	0.565	0.598	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
2	E9PEP7	0.0	1477	755	0.937	0.999	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
3	P08048	0.0	1503	801	0.925	0.930	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
4	P17010	0.0	1659	805	1.000	1.000	ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2
5	P17012	0.0	1560	799	0.950	0.957	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2
6	P20662	0.0	1098	777	0.684	0.709	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
7	Q9Y462	0.0	824	761	0.558	0.590	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
8	Q05481	1.22e-55	210	1191	0.169	0.114	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	Q03923	2.16e-55	203	595	0.160	0.217	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
10	Q86WZ6	3.83e-55	206	799	0.166	0.168	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
11	Q8TD23	5.71e-55	201	568	0.163	0.231	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
12	Q49A12	7.63e-55	200	536	0.160	0.241	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
13	Q02386	2.32e-54	202	682	0.165	0.195	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
14	Q9UJW7	5.64e-54	202	825	0.166	0.162	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
15	Q8IYB9	7.65e-54	199	648	0.159	0.198	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	P35789	3.79e-53	197	620	0.166	0.216	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
17	A6NNF4	3.91e-53	197	616	0.169	0.221	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
18	Q8TA94	3.93e-53	194	476	0.147	0.248	ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens OX=9606 GN=ZNF563 PE=1 SV=1
19	O75437	5.52e-53	197	659	0.164	0.200	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
20	Q14585	6.37e-53	193	488	0.155	0.256	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02892 zf-BED	73	14.8	BED zinc finger
2	PF00096 zf-C2H2	5.9e-39	141.5	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	49	15.1	zinc-finger C2H2-type
4	PF18868 zf-C2H2_3rep	27	16.9	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	1.1e-27	105.3	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	4.8e-09	47.5	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	1.3e-32	122.0	Zinc-finger double domain
8	PF13909 zf-H2C2_5	1.7e-23	93.3	C2H2-type zinc-finger domain
9	PF04704 Zfx_Zfy_act	5.7e-162	550.0	Zfx / Zfy transcription activation region
10	PF17032 zinc_ribbon_15	0.00018	33.5	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316357	0.821	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
2	9606.ENSP00000382840	0.793	ATP-dependent RNA helicase DDX3X
3	9606.ENSP00000262848	0.781	cAMP-dependent protein kinase catalytic subunit PRKX
4	9606.ENSP00000362744	0.781	Ribosomal protein S4, X-linked
5	9606.ENSP00000336528	0.743	Nuclear receptor subfamily 1 group I member 2
6	9606.ENSP00000338413	0.741	Ubiquitin-like modifier-activating enzyme 1
7	9606.ENSP00000217964	0.720	F-box-like/WD repeat-containing protein TBL1X
8	9606.ENSP00000244711	0.720	Male-enhanced antigen 1
9	9606.ENSP00000367203	0.715	Lysine-specific demethylase 6A
10	9606.ENSP00000259915	0.700	POU domain, class 5, transcription factor 1
11	9606.ENSP00000422488	0.698	Steroid hormone receptor ERR2
12	9606.ENSP00000370485	0.688	Neuroligin-4, X-linked
13	9606.ENSP00000364550	0.682	Lysine-specific demethylase 5C
14	9606.ENSP00000368349	0.678	DNA polymerase alpha catalytic subunit
15	9606.ENSP00000369320	0.678	Retinoschisin
16	9606.ENSP00000368927	0.666	Eukaryotic translation initiation factor 1A, X-chromosomal
17	9606.ENSP00000369465	0.662	Gamma-taxilin
18	9606.ENSP00000359668	0.657	Transcription cofactor vestigial-like protein 1
19	9606.ENSP00000396452	0.641	Pseudouridine-5'-phosphatase
20	9606.ENSP00000381504	0.634	Ribose-phosphate pyrophosphokinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0140110	0.905	transcription regulator activity
GO:0003690	0.904	double-stranded DNA binding
GO:0001067	0.900	transcription regulatory region nucleic acid binding
GO:1990837	0.890	sequence-specific double-stranded DNA binding
GO:0000976	0.883	transcription cis-regulatory region binding
GO:0003700	0.841	DNA-binding transcription factor activity
GO:0000981	0.827	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.809	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.695	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.641	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.456	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0048518	0.926	positive regulation of biological process
GO:0048522	0.913	positive regulation of cellular process
GO:0010604	0.873	positive regulation of macromolecule metabolic process
GO:0006357	0.872	regulation of transcription by RNA polymerase II
GO:0045935	0.865	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.858	positive regulation of macromolecule biosynthetic process
GO:0031328	0.855	positive regulation of cellular biosynthetic process
GO:0045893	0.847	positive regulation of DNA-templated transcription
GO:0009987	0.792	cellular process
GO:0045944	0.786	positive regulation of transcription by RNA polymerase II
GO:0032502	0.410	developmental process
GO:0032501	0.335	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043228	0.995	non-membrane-bounded organelle
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005730	0.965	nucleolus
GO:0005737	0.586	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]