StarFunc result for job id P17025

User Input

>input (639 residues)
MTPASASGEDSGSFYSWQKAKREQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETY
SNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQ
VGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAE
NKYDNGCAKLFFHTEYEKTNPGMKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACR
KTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFR
EKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLD
LIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVH
QRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGH
TGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEK
PYECPVCWKAFSQKSQLIIHQRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKC
TECGKAFTQKSNLIVHQRTHAGKKAHGRGHTRKSKFMAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51523	0.459	0.407	9.700E-61	738	0.549	0.476	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
2	AFDB:Q06732	0.368	0.305	1.756E-58	778	0.529	0.434	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:A0A024R4I3	0.444	0.436	1.532E-57	652	0.480	0.471	A0A024R4I3.pdb.gz
4	AFDB:A0A024R4S7	0.449	0.377	1.902E-57	792	0.477	0.385	A0A024R4S7.pdb.gz
5	AFDB:Q5MCW4	0.500	0.468	2.296E-56	686	0.488	0.455	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
6	AFDB:P17014	0.490	0.455	9.909E-56	697	0.490	0.449	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
7	AFDB:Q8N184	0.396	0.393	1.703E-55	647	0.484	0.478	Q8N184.pdb.gz	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
8	AFDB:Q6ECI4	0.422	0.381	1.898E-55	717	0.452	0.403	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
9	AFDB:Q02386	0.504	0.476	5.030E-55	682	0.446	0.418	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
10	AFDB:Q9HCZ1	0.299	0.284	1.196E-54	680	0.455	0.428	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
11	PDB:3w5kB	0.078	0.259	1.235E-4	110	0.069	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ena4	0.075	0.092	6.420E-1	457	0.081	0.114	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7fikP	0.089	0.094	7.154E-1	593	0.047	0.051	7fikP.pdb.gz
14	PDB:7o4iW	0.048	0.082	7.552E-1	312	0.069	0.141	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:8ap8d	0.060	0.099	7.552E-1	270	0.053	0.126	8ap8d.pdb.gz
16	PDB:6lsr0	0.041	0.125	1.298	190	0.041	0.137	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:5c8dE	0.073	0.111	1.612	280	0.027	0.061	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
18	PDB:7ad8D	0.050	0.077	2.002	280	0.056	0.129	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
19	PDB:6ff4t	0.039	0.102	2.231	172	0.038	0.140	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7cunA	0.066	0.060	2.355	730	0.036	0.032	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS50	0.0	594	604	0.493	0.522	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
2	O94892	0.0	578	652	0.501	0.491	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
3	P15620	0.0	530	580	0.405	0.447	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
4	P17014	0.0	575	697	0.520	0.476	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
5	P51523	0.0	568	738	0.437	0.378	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
6	P51814	0.0	565	821	0.509	0.396	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
7	P52742	0.0	570	658	0.499	0.485	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
8	Q14587	0.0	558	947	0.435	0.294	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
9	Q5MCW4	0.0	542	686	0.405	0.378	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
10	Q6ECI4	0.0	533	717	0.465	0.414	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	Q8N184	0.0	597	647	0.510	0.504	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
12	Q8TAQ5	0.0	559	688	0.493	0.458	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
13	Q96RE9	0.0	594	604	0.493	0.522	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
14	Q9BX82	0.0	545	626	0.463	0.473	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
15	Q9HCZ1	0.0	541	680	0.482	0.453	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
16	Q9P2J8	0.0	554	865	0.480	0.355	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
17	Q06732	1.52e-180	533	778	0.430	0.353	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
18	A0A0U1RQ46	5.15e-179	523	609	0.454	0.476	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
19	A2AWF2	4.22e-178	523	685	0.457	0.426	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
20	Q9Y473	7.00e-178	524	711	0.459	0.412	ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens OX=9606 GN=ZNF175 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.1	23.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF07975 C1_4	0.0011	30.5	TFIIH C1-like domain
3	PF14353 CpXC	0.02	26.3	CpXC protein
4	PF16288 DUF4934	1.7e+02	13.7	Domain of unknown function (DUF4934)
5	PF01352 KRAB	1.4e-21	87.2	KRAB box
6	PF01286 XPA_N	6.3e+02	11.8	XPA protein N-terminal
7	PF01428 zf-AN1	4.4e+02	12.5	AN1-like Zinc finger
8	PF00096 zf-C2H2	1.1e-86	291.8	Zinc finger, C2H2 type
9	PF13894 zf-C2H2_4	3.2e-46	163.0	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	3.4e-18	76.4	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	1.7e-11	55.3	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	1.1e-103	346.7	Zinc-finger double domain
13	PF17032 zinc_ribbon_15	0.038	26.1	zinc-ribbon family
14	PF09723 Zn-ribbon_8	2.5e-07	42.0	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290277	0.821	Serine/threonine-protein kinase A-Raf
2	9606.ENSP00000432695	0.757	Probable tRNA methyltransferase 9-like protein
3	9606.ENSP00000365962	0.688	TBC1 domain family member 25
4	9606.ENSP00000306095	0.653	Olfactory receptor 10H2
5	9606.ENSP00000363972	0.650	Zinc finger C4H2 domain-containing protein
6	9606.ENSP00000218388	0.642	Metalloproteinase inhibitor 1
7	9606.ENSP00000305847	0.618	Sperm acrosome associated 5
8	9606.ENSP00000304762	0.616	Sperm acrosome associated 5B
9	9606.ENSP00000269445	0.601	Dymeclin
10	9606.ENSP00000365919	0.573	WD repeat-containing protein 13
11	9606.ENSP00000361602	0.564	Zinc finger protein 503
12	9606.ENSP00000401018	0.551	GINS complex subunit 3
13	9606.ENSP00000349689	0.545	Palmitoyltransferase ZDHHC9
14	9606.ENSP00000360497	0.520	RING finger protein 113A
15	9606.ENSP00000328848	0.519	RNA-binding protein 10
16	9606.ENSP00000378286	0.516	Zinc finger and BTB domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0031323	0.923	regulation of cellular metabolic process
GO:0060255	0.915	regulation of macromolecule metabolic process
GO:0080090	0.903	regulation of primary metabolic process
GO:0010468	0.846	regulation of gene expression
GO:2001141	0.831	regulation of RNA biosynthetic process
GO:1903506	0.639	regulation of nucleic acid-templated transcription
GO:0009987	0.593	cellular process
GO:0006355	0.556	regulation of DNA-templated transcription
GO:0048523	0.490	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.977	nucleoplasm
GO:0005737	0.655	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]