StarFunc result for job id P17026

User Input

>input (224 residues)
MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTEC
EKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESF
KQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSS
HLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7T4	0.640	0.640	3.296E-31	224	1.000	1.000	A0A024R7T4.pdb.gz
2	AFDB:Q9ERU2	0.640	0.605	2.585E-28	237	0.857	0.810	Q9ERU2.pdb.gz	ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus OX=10116 GN=Znf22 PE=2 SV=2
3	AFDB:Q9BRH9	0.585	0.201	1.769E-18	671	0.415	0.139	Q9BRH9.pdb.gz	ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens OX=9606 GN=ZNF251 PE=1 SV=4
4	AFDB:Q9HBT8	0.577	0.259	2.265E-18	521	0.397	0.171	Q9HBT8.pdb.gz	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1
5	AFDB:Q9UJW8	0.592	0.202	2.725E-18	692	0.411	0.133	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
6	AFDB:P17036	0.608	0.310	3.488E-18	446	0.473	0.238	P17036.pdb.gz	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
7	AFDB:P17097	0.604	0.205	3.488E-18	686	0.424	0.138	P17097.pdb.gz	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
8	AFDB:Q6ZN57	0.603	0.299	4.749E-18	461	0.420	0.204	Q6ZN57.pdb.gz	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
9	AFDB:P0CG24	0.545	0.335	5.373E-18	379	0.384	0.227	P0CG24.pdb.gz	ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens OX=9606 GN=ZNF883 PE=1 SV=1
10	AFDB:P17020	0.602	0.203	6.465E-18	682	0.406	0.133	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
11	PDB:3w5kB	0.171	0.260	8.913E-5	110	0.174	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5xbtA	0.091	0.080	1.730	271	0.080	0.066	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
13	PDB:5a31B	0.077	0.158	2.505	84	0.045	0.119	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
14	PDB:7ad8D	0.085	0.071	2.833	280	0.049	0.039	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:7cunA	0.114	0.056	2.833	730	0.103	0.032	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
16	PDB:6elzm	0.107	0.048	3.206	645	0.125	0.043	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
17	PDB:7o4iW	0.094	0.071	3.206	312	0.076	0.054	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
18	PDB:5gm6a	0.066	0.103	4.642	123	0.067	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5o85D	0.084	0.186	4.642	53	0.045	0.189	5o85D.pdb.gz	The intricate network between the p34 and p44 subunits is central to the activity of the transcription/DNA repair factor TFIIH.
20	PDB:7nacm	0.124	0.053	4.642	666	0.107	0.036	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17026	7.22e-166	457	224	1.000	1.000	ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens OX=9606 GN=ZNF22 PE=1 SV=3
2	Q9ERU3	2.90e-140	394	237	0.862	0.814	ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus OX=10090 GN=Znf22 PE=1 SV=2
3	Q9ERU2	1.19e-138	389	237	0.857	0.810	ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus OX=10116 GN=Znf22 PE=2 SV=2
4	Q86U76	1.79e-67	214	410	0.442	0.241	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
5	P17036	2.66e-67	215	446	0.442	0.222	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
6	Q15937	1.00e-62	204	498	0.424	0.191	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
7	A0A0C4DG42	2.18e-62	205	539	0.420	0.174	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
8	Q6ZN57	2.50e-62	202	461	0.446	0.217	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
9	Q8IZ26	2.53e-62	205	560	0.420	0.168	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
10	Q9C0F3	1.84e-61	201	470	0.406	0.194	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
11	Q8NF99	3.34e-61	201	534	0.415	0.174	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
12	Q8NA42	1.72e-60	198	475	0.415	0.196	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
13	Q15776	2.71e-60	200	578	0.393	0.152	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
14	P10073	6.35e-60	197	491	0.384	0.175	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
15	Q9HBT8	7.24e-60	198	521	0.397	0.171	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1
16	Q8TF45	1.06e-59	200	676	0.415	0.138	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
17	Q9P0L1	1.18e-59	201	754	0.411	0.122	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
18	Q96CX3	2.38e-59	189	271	0.438	0.362	ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens OX=9606 GN=ZNF501 PE=2 SV=2
19	P35789	3.37e-59	198	620	0.424	0.153	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
20	P52742	3.54e-59	199	658	0.415	0.141	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	15	16.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF07975 C1_4	62	15.3	TFIIH C1-like domain
3	PF07754 HVO_2753_ZBP	5.5	18.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
4	PF01286 XPA_N	16	16.9	XPA protein N-terminal
5	PF14149 YhfH	5.3e+02	12.0	YhfH-like protein
6	PF00096 zf-C2H2	1.1e-31	118.6	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	5.1e-05	34.2	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	2e-16	70.2	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	0.035	25.4	C2H2-type zinc finger
10	PF13465 zf-H2C2_2	5.6e-35	129.4	Zinc-finger double domain
11	PF13909 zf-H2C2_5	0.24	22.5	C2H2-type zinc-finger domain
12	PF02591 zf-RING_7	56	15.3	C4-type zinc ribbon domain
13	PF18439 zf_UBZ	0.012	26.6	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	17	17.5	zinc-ribbon family
15	PF09723 Zn-ribbon_8	0.91	21.0	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262134	0.784	Lysophosphatidylcholine acyltransferase 2
2	9606.ENSP00000337512	0.744	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
3	9606.ENSP00000359837	0.742	ZZ-type zinc finger-containing protein 3
4	9606.ENSP00000479504	0.740	Probable ATP-dependent RNA helicase DDX52
5	9606.ENSP00000412209	0.687	Interleukin-5 receptor subunit alpha
6	9606.ENSP00000326261	0.686	Serine/arginine repetitive matrix protein 1
7	9606.ENSP00000346012	0.685	Belongs to the eukaryotic ribosomal protein eL42 family.
8	9606.ENSP00000428223	0.684	Ribosomal protein L26 like 1
9	9606.ENSP00000346050	0.682	40S ribosomal protein S3a
10	9606.ENSP00000260953	0.670	Methyltransferase-like protein 5
11	9606.ENSP00000484146	0.662	Semaphorin-3B
12	9606.ENSP00000339566	0.648	Histone H1.2
13	9606.ENSP00000308759	0.645	Zinc finger and BTB domain-containing protein 21
14	9606.ENSP00000307746	0.583	Zinc finger protein 608
15	9606.ENSP00000371397	0.577	Protein FAM43A
16	9606.ENSP00000338217	0.569	Zinc finger protein 532
17	9606.ENSP00000332576	0.564	Oxysterol-binding protein 2
18	9606.ENSP00000380659	0.554	Eukaryotic translation initiation factor 4E transporter
19	9606.ENSP00000286544	0.533	Protein FAM161B
20	9606.ENSP00000326630	0.507	Zinc finger protein ZFPM1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0046872	0.997	metal ion binding
GO:0008270	0.989	zinc ion binding
GO:0097159	0.945	organic cyclic compound binding
GO:1901363	0.936	heterocyclic compound binding
GO:0003676	0.930	nucleic acid binding
GO:0003677	0.821	DNA binding
GO:0140110	0.523	transcription regulator activity
GO:0003700	0.508	DNA-binding transcription factor activity
GO:0043565	0.332	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.974	biological regulation
GO:0050789	0.946	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0009987	0.845	cellular process
GO:0019222	0.691	regulation of metabolic process
GO:0060255	0.597	regulation of macromolecule metabolic process
GO:0031323	0.589	regulation of cellular metabolic process
GO:0009889	0.570	regulation of biosynthetic process
GO:0051171	0.569	regulation of nitrogen compound metabolic process
GO:0080090	0.558	regulation of primary metabolic process
GO:0031326	0.453	regulation of cellular biosynthetic process
GO:0010556	0.438	regulation of macromolecule biosynthetic process
GO:0010468	0.422	regulation of gene expression
GO:0048519	0.300	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.979	nucleoplasm
GO:0005737	0.822	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]