StarFunc result for job id P17027

User Input

>input (643 residues)
MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMY
EGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEEC
FFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCD
SQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYI
THQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQR
VHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTG
EKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPY
ECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNE
CGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKA
FSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFS
SDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17027	1.000	1.000	1.024E-102	643	1.000	1.000	P17027.pdb.gz	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
2	AFDB:Q14587	0.441	0.326	3.497E-59	947	0.465	0.316	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
3	AFDB:P52742	0.537	0.527	5.973E-59	658	0.473	0.462	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
4	AFDB:Q6ECI4	0.621	0.562	1.264E-58	717	0.463	0.416	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
5	AFDB:P51814	0.488	0.407	3.314E-57	821	0.456	0.357	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
6	AFDB:Q8NDQ6	0.509	0.497	3.688E-57	660	0.459	0.447	Q8NDQ6.pdb.gz	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
7	AFDB:Q9P2J8	0.420	0.322	4.105E-57	865	0.460	0.342	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
8	AFDB:Q06732	0.537	0.457	4.331E-57	778	0.440	0.364	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
9	AFDB:P51523	0.436	0.385	5.972E-57	738	0.487	0.424	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	AFDB:Q99PJ6	0.488	0.437	2.535E-56	736	0.428	0.374	Q99PJ6.pdb.gz	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1
11	PDB:3w5kB	0.078	0.262	4.672E-4	110	0.065	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7o4iW	0.047	0.078	7.979E-1	312	0.058	0.119	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:6rqhR	0.077	0.115	8.881E-1	330	0.072	0.139	6rqhR.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
14	PDB:7o4i1	0.057	0.066	1.043	522	0.082	0.102	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:7evoC	0.069	0.091	1.363	422	0.040	0.062	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:7ad8D	0.037	0.055	1.517	280	0.030	0.068	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	PDB:5c8dE	0.057	0.100	1.601	280	0.031	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
18	PDB:7ena4	0.075	0.092	1.601	457	0.067	0.094	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:2p01A	0.063	0.089	2.092	323	0.089	0.176	2p01A.pdb.gz
20	PDB:5gm6a	0.033	0.124	2.092	123	0.036	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	552	609	0.443	0.468	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	O75290	555	641	0.462	0.463	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
3	P15620	542	580	0.411	0.455	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
4	P17020	562	682	0.456	0.430	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
5	P17021	540	662	0.401	0.390	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
6	P17027	1317	643	1.000	1.000	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
7	P35789	548	620	0.446	0.463	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
8	P51523	551	738	0.434	0.378	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	P51814	536	821	0.414	0.324	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
10	P52742	559	658	0.482	0.471	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
11	Q05481	549	1191	0.425	0.229	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
12	Q14585	530	488	0.401	0.529	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
13	Q14587	555	947	0.435	0.296	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
14	Q5MCW4	566	686	0.496	0.465	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
15	Q5TYW1	546	1059	0.439	0.266	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
16	Q6ECI4	593	717	0.491	0.441	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
17	Q76KX8	550	674	0.453	0.432	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
18	Q7TMN8	538	578	0.415	0.462	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
19	Q7Z3V5	563	609	0.453	0.478	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
20	Q8BLA2	537	578	0.414	0.460	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	1.6e+02	13.7	Rad4 beta-hairpin domain 1
2	PF07975 C1_4	0.00023	32.7	TFIIH C1-like domain
3	PF12552 DUF3741	0.00011	33.3	Protein of unknown function (DUF3741)
4	PF14333 DUF4389	5.6e+02	11.9	Domain of unknown function (DUF4389)
5	PF20026 DUF6434	43	15.5	Domain of unknown function (DUF6434)
6	PF01352 KRAB	3.6e+02	12.2	KRAB box
7	PF10579 Rapsyn_N	8.7	17.8	Rapsyn N-terminal myristoylation and linker region
8	PF00096 zf-C2H2	5.1e-74	251.9	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	3.6e-18	76.3	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	1.1e-44	158.1	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	4.3e-07	41.0	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	1.7	20.2	Zinc-finger double-stranded RNA-binding
13	PF13465 zf-H2C2_2	1.9e-121	402.9	Zinc-finger double domain
14	PF18439 zf_UBZ	3.6e-05	34.6	Ubiquitin-Binding Zinc Finger
15	PF17032 zinc_ribbon_15	0.0024	29.9	zinc-ribbon family
16	PF09723 Zn-ribbon_8	5.4e-12	57.0	Zinc ribbon domain
17	PF12760 Zn_Tnp_IS1595	96	14.3	Transposase zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387673

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263317	0.767	NADPH oxidase 4
2	9606.ENSP00000356567	0.550	Acyl-CoA-binding domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.698	heterocyclic compound binding
GO:0097159	0.698	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.927	regulation of biological process
GO:0050794	0.896	regulation of cellular process
GO:0019222	0.696	regulation of metabolic process
GO:0051171	0.692	regulation of nitrogen compound metabolic process
GO:0080090	0.690	regulation of primary metabolic process
GO:0060255	0.689	regulation of macromolecule metabolic process
GO:0009987	0.671	cellular process
GO:2001141	0.633	regulation of RNA biosynthetic process
GO:0010468	0.456	regulation of gene expression
GO:0050896	0.451	response to stimulus
GO:0006355	0.326	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.957	cytoplasm
GO:0005829	0.414	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]