StarFunc result for job id P17028

User Input

>input (368 residues)
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RC47	0.380	0.380	8.333E-54	368	0.997	0.997	A0A024RC47.pdb.gz
2	AFDB:Q9BRR0	0.311	0.224	1.921E-28	538	0.465	0.318	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
3	AFDB:Q9H4T2	0.353	0.374	2.709E-28	348	0.446	0.471	Q9H4T2.pdb.gz	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
4	AFDB:O15535	0.294	0.277	1.601E-27	394	0.462	0.431	O15535.pdb.gz	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
5	AFDB:Q86W11	0.320	0.242	1.902E-27	494	0.457	0.340	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
6	AFDB:Q8NF99	0.296	0.206	3.373E-27	534	0.421	0.290	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
7	AFDB:O43309	0.302	0.188	7.525E-27	604	0.440	0.268	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
8	AFDB:P17029	0.308	0.206	1.061E-26	563	0.467	0.306	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
9	AFDB:Q96LW9	0.300	0.273	1.585E-26	406	0.457	0.414	Q96LW9.pdb.gz	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
10	AFDB:Q3MJ62	0.297	0.281	3.745E-26	389	0.462	0.437	Q3MJ62.pdb.gz	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
11	PDB:3w5kB	0.120	0.276	4.120E-5	110	0.111	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dgeSM	0.066	0.118	7.432E-1	159	0.076	0.176	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
13	PDB:6hivBM	0.117	0.154	1.478	245	0.071	0.106	6hivBM.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:5n5yI	0.047	0.146	1.566	99	0.052	0.192	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
15	PDB:4n78F	0.082	0.161	1.859	156	0.062	0.147	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
16	PDB:6n8jb	0.090	0.056	1.859	647	0.128	0.073	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
17	PDB:6hlqI	0.045	0.126	1.969	111	0.041	0.135	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
18	PDB:6hivCb	0.103	0.119	2.085	252	0.057	0.083	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6tedR	0.075	0.108	2.208	244	0.054	0.082	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
20	PDB:5lj5O	0.065	0.083	2.476	283	0.125	0.163	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17028	0.0	756	368	1.000	1.000	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
2	Q91VN1	0.0	724	368	0.951	0.951	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
3	Q96N95	3.44e-116	342	335	0.522	0.573	ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens OX=9606 GN=ZNF396 PE=1 SV=2
4	Q3MJ62	6.95e-114	338	389	0.481	0.455	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
5	Q96LW9	4.30e-111	332	406	0.492	0.446	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
6	Q9H4T2	8.46e-103	308	348	0.470	0.497	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
7	O15535	3.45e-97	296	394	0.465	0.434	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
8	Q9UNY5	1.60e-93	287	417	0.481	0.424	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
9	O43309	1.98e-93	293	611	0.462	0.278	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
10	I3L4J6	4.78e-93	286	435	0.465	0.393	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
11	Q86W11	4.94e-92	286	494	0.492	0.366	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
12	Q9BRR0	6.26e-89	279	538	0.478	0.327	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
13	Q8NF99	2.13e-88	278	534	0.462	0.318	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
14	Q07231	9.52e-87	274	555	0.484	0.321	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
15	Q9Y5A6	1.41e-86	271	473	0.448	0.349	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
16	Q3ZBY5	6.16e-86	269	466	0.462	0.365	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
17	P10073	4.47e-78	250	491	0.435	0.326	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
18	Q16670	4.49e-72	234	478	0.380	0.293	ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2
19	A0A024RCN4	6.62e-72	233	479	0.383	0.294	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1
20	Q15776	1.04e-70	233	578	0.432	0.275	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	52	15.5	TFIIH C1-like domain
2	PF12773 DZR	0.052	24.9	Double zinc ribbon
3	PF02023 SCAN	3.8e-39	143.7	SCAN domain
4	PF01286 XPA_N	0.18	23.1	XPA protein N-terminal
5	PF14149 YhfH	2.7e+02	12.9	YhfH-like protein
6	PF02892 zf-BED	7.2e+02	11.6	BED zinc finger
7	PF00096 zf-C2H2	2.2e-20	83.0	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	14	16.9	zinc-finger C2H2-type
9	PF13894 zf-C2H2_4	1.2e-09	49.1	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	0.013	26.8	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	0.0007	31.0	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	2.3e-21	86.4	Zinc-finger double domain
13	PF08790 zf-LYAR	0.29	22.3	LYAR-type C2HC zinc finger
14	PF18387 zf_C2H2_ZHX	2.3e+02	12.9	Zinc-fingers and homeoboxes C2H2 finger domain
15	PF18439 zf_UBZ	0.95	20.5	Ubiquitin-Binding Zinc Finger
16	PF09723 Zn-ribbon_8	0.013	26.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302310	0.879	Zinc finger protein 396
2	9606.ENSP00000338860	0.878	Zinc finger protein 444
3	9606.ENSP00000472802	0.875	Zinc finger protein 446
4	9606.ENSP00000363103	0.872	SCAN domain-containing protein 1
5	9606.ENSP00000380057	0.871	Zinc finger and SCAN domain-containing protein 32
6	9606.ENSP00000331577	0.839	Zinc finger protein 397
7	9606.ENSP00000268655	0.807	Zinc finger protein 174
8	9606.ENSP00000366509	0.786	Zinc finger protein with KRAB and SCAN domains 4
9	9606.ENSP00000296417	0.779	Histone H2A.Z
10	9606.ENSP00000300249	0.767	Microtubule-associated protein RP/EB family member 2
11	9606.ENSP00000250076	0.743	Zinc finger protein 232
12	9606.ENSP00000428585	0.711	Small integral membrane protein 12
13	9606.ENSP00000235835	0.705	Aflatoxin B1 aldehyde reductase member 2
14	9606.ENSP00000319974	0.698	HMG box transcription factor BBX
15	9606.ENSP00000340279	0.694	Afadin- and alpha-actinin-binding protein
16	9606.ENSP00000257981	0.689	Potassium voltage-gated channel subfamily H member 3
17	9606.ENSP00000259883	0.686	PiggyBac transposable element-derived protein 1
18	9606.ENSP00000366465	0.685	Zinc finger protein with KRAB and SCAN domains 3
19	9606.ENSP00000311679	0.684	Zinc finger protein 483
20	9606.ENSP00000313601	0.679	Coiled-coil and C2 domain-containing protein 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.998	transcription regulator activity
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0043565	0.990	sequence-specific DNA binding
GO:0003700	0.982	DNA-binding transcription factor activity
GO:1990837	0.866	sequence-specific double-stranded DNA binding
GO:0042802	0.801	identical protein binding
GO:0000981	0.386	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0048523	0.824	negative regulation of cellular process
GO:0051172	0.805	negative regulation of nitrogen compound metabolic process
GO:0031324	0.805	negative regulation of cellular metabolic process
GO:0010605	0.797	negative regulation of macromolecule metabolic process
GO:0006357	0.785	regulation of transcription by RNA polymerase II
GO:0009987	0.784	cellular process
GO:0010558	0.762	negative regulation of macromolecule biosynthetic process
GO:0031327	0.762	negative regulation of cellular biosynthetic process
GO:1902679	0.743	negative regulation of RNA biosynthetic process
GO:1903507	0.733	negative regulation of nucleic acid-templated transcription
GO:0045892	0.721	negative regulation of DNA-templated transcription
GO:0048518	0.713	positive regulation of biological process
GO:0048522	0.588	positive regulation of cellular process
GO:0010604	0.490	positive regulation of macromolecule metabolic process
GO:0051254	0.447	positive regulation of RNA metabolic process
GO:0010557	0.443	positive regulation of macromolecule biosynthetic process
GO:0045893	0.351	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.581	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]