StarFunc result for job id P17030

User Input

>input (456 residues)
MNKFQGPVTLKDVIVEFTKEEWKLLTPAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKL
KQGKEPWILEVEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTHTTEKACEC
KECGKFFCQKSALIVHQHTHSKGKSYDCDKCGKSFSKNEDLIRHQKIHTRDKTYECKECK
KIFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLTEHQKTHTGEKPFECTECGKFFY
VKAYLMVHQKTHTGEKPYECKECGKAFSQKSHLTVHQRMHTGEKPYKCKECGKFFSRNSH
LKTHQRSHTGEKPYECKECRKCFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKH
QRKHTGEKPYECTECGKSFAVNSVLRLHQRTHTGEKPYACKECGKSFSQKSHFIIHQRKH
TGEKPYECQECGETFIQKSQLTAHQKTHTKKRNAEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17030	1.000	1.000	5.303E-77	456	1.000	1.000	P17030.pdb.gz	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
2	AFDB:Q5MCW4	0.657	0.448	8.854E-48	686	0.553	0.367	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
3	AFDB:A0A0A0MS50	0.624	0.484	3.378E-47	604	0.572	0.432	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
4	AFDB:A0A0U1RQ46	0.520	0.407	4.993E-47	609	0.474	0.355	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
5	AFDB:P17014	0.557	0.379	1.153E-46	697	0.579	0.379	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
6	AFDB:A0A024R4I3	0.352	0.258	1.441E-46	652	0.550	0.385	A0A024R4I3.pdb.gz
7	AFDB:Q8N184	0.511	0.379	1.524E-46	647	0.546	0.385	Q8N184.pdb.gz	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
8	AFDB:P51814	0.592	0.346	2.662E-46	821	0.550	0.306	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
9	AFDB:P17031	0.594	0.515	3.934E-46	533	0.485	0.415	P17031.pdb.gz	ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens OX=9606 GN=ZNF26 PE=1 SV=3
10	AFDB:Q9HCZ1	0.442	0.326	5.814E-46	680	0.561	0.376	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
11	PDB:3w5kB	0.106	0.259	3.279E-4	110	0.090	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.043	0.205	3.134E-1	62	0.029	0.210	6ydhA.pdb.gz
13	PDB:5dkaA	0.063	0.237	9.566E-1	96	0.039	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:5xncB	0.064	0.074	1.414	354	0.029	0.037	5xncB.pdb.gz	Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
15	PDB:6gejS	0.064	0.112	1.414	208	0.070	0.154	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:7pt6I	0.067	0.083	1.581	341	0.059	0.079	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
17	PDB:3j9qA	0.060	0.071	1.671	385	0.033	0.039	3j9qA.pdb.gz
18	PDB:4z4kA	0.067	0.098	1.671	282	0.029	0.046	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
19	PDB:5c8dE	0.073	0.099	1.767	280	0.042	0.068	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
20	PDB:7ad8D	0.059	0.084	1.868	280	0.046	0.075	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17030	0.0	930	456	1.000	1.000	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
2	Q6PCM4	1.25e-157	460	567	0.537	0.432	Q6PCM4_MOUSE Zinc finger protein 157 OS=Mus musculus OX=10090 GN=Zfp157 PE=2 SV=1
3	Q8NA42	1.04e-154	449	475	0.515	0.495	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
4	P17031	1.21e-152	446	533	0.498	0.426	ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens OX=9606 GN=ZNF26 PE=1 SV=3
5	P17032	2.91e-151	443	561	0.557	0.453	ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens OX=9606 GN=ZNF37A PE=2 SV=3
6	A0A0A0MS50	3.50e-150	442	604	0.482	0.364	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
7	Q96RE9	3.73e-150	442	604	0.482	0.364	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
8	Q9C0F3	5.07e-150	437	470	0.507	0.491	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
9	P51523	3.32e-149	444	738	0.522	0.322	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	Q9NYW8	2.53e-148	441	714	0.520	0.332	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
11	Q8TAQ5	9.92e-148	439	688	0.522	0.346	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
12	Q06732	5.02e-147	439	778	0.498	0.292	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
13	A0A0U1RQ46	6.73e-147	434	609	0.487	0.365	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
14	O94892	5.68e-146	433	652	0.526	0.368	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
15	P17014	2.22e-145	433	697	0.568	0.372	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
16	Q5MCW4	2.65e-144	430	686	0.524	0.348	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
17	Q96HQ0	5.15e-144	423	510	0.476	0.425	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
18	Q6ZN57	1.89e-143	420	461	0.447	0.443	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
19	Q6PF04	6.11e-142	421	617	0.518	0.382	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
20	Q8NCK3	9.01e-141	412	441	0.461	0.476	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	1.4	20.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF07975 C1_4	3.4	19.3	TFIIH C1-like domain
3	PF01352 KRAB	8.4e-20	81.4	KRAB box
4	PF00096 zf-C2H2	9.3e-67	229.1	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	2.3e-30	113.6	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	7e-06	37.2	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	7.4	18.2	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	1.1e-85	289.8	Zinc-finger double domain
9	PF12874 zf-met	81	15.0	Zinc-finger of C2H2 type
10	PF18439 zf_UBZ	0.0068	27.4	Ubiquitin-Binding Zinc Finger
11	PF17032 zinc_ribbon_15	0.0038	29.3	zinc-ribbon family
12	PF09723 Zn-ribbon_8	0.0015	30.0	Zinc ribbon domain
13	PF17283 Zn_ribbon_SprT	8.3	17.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302222

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.616	Transcription intermediary factor 1-beta
2	9606.ENSP00000359837	0.534	ZZ-type zinc finger-containing protein 3
3	9606.ENSP00000421853	0.524	Ran-binding protein 3-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.557	organic cyclic compound binding
GO:1901363	0.536	heterocyclic compound binding
GO:0003676	0.486	nucleic acid binding
GO:0003677	0.417	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:2001141	0.974	regulation of RNA biosynthetic process
GO:0010468	0.925	regulation of gene expression
GO:0006355	0.900	regulation of DNA-templated transcription
GO:0051253	0.873	negative regulation of RNA metabolic process
GO:0031327	0.791	negative regulation of cellular biosynthetic process
GO:0010558	0.787	negative regulation of macromolecule biosynthetic process
GO:0009987	0.748	cellular process
GO:0006357	0.435	regulation of transcription by RNA polymerase II
GO:0071704	0.422	organic substance metabolic process
GO:1902679	0.390	negative regulation of RNA biosynthetic process
GO:0044238	0.371	primary metabolic process
GO:0006807	0.366	nitrogen compound metabolic process
GO:0043170	0.353	macromolecule metabolic process
GO:0045892	0.336	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.988	cytoplasm
GO:0005829	0.737	cytosol
GO:0043232	0.528	intracellular non-membrane-bounded organelle
GO:0032991	0.434	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]