StarFunc result for job id P17032

User Input

>input (561 residues)
MITSQGSVSFRDVTVGFTQEEWQHLDPAQRTLYRDVMLENYSHLVSVGYCIPKPEVILKL
EKGEEPWILEEKFPSQSHLELINTSRNYSIMKFNEFNKGGKCFCDEKHEIIHSEEEPSEY
NKNGNSFWLNEDLIWHQKIKNWEQSFEYNECGKAFPENSLFLVHKRGYTGQKTCKYTEHG
KTCDMSFFITHQQTHPRENHYGNECGENIFEESILLEHQSVYPFSQKLNLTPIQRTHSIN
NIIEYNECGTFFSEKLVLHLQQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYE
CHECGKTFYKNSDLIKHQRIHTGERPYGCHECGKSFSEKSTLTQHQRTHTGEKPYECHEC
GKTFSFKSVLTVHQKTHTGEKPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSF
SEKSTLTKHLRTHTGEKPYECIQCGKFFCYYSGFTEHLRRHTGEKPFGCNECGKTFRQKS
ALIVHQRTHIRQKPYGCNQCGKSFCVKSKLIAHHRTHTGEKPYECNVCGKSFYVKSKLTV
HQRIHLGRNPINVVNEGNYSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17032	1.000	1.000	6.212E-92	561	1.000	1.000	P17032.pdb.gz	ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens OX=9606 GN=ZNF37A PE=2 SV=3
2	AFDB:Q06732	0.452	0.338	4.762E-52	778	0.581	0.419	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:A0A0A0MS50	0.427	0.401	3.707E-49	604	0.483	0.449	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
4	AFDB:Q8N184	0.506	0.442	1.532E-48	647	0.512	0.444	Q8N184.pdb.gz	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
5	AFDB:P17014	0.453	0.373	1.617E-48	697	0.503	0.405	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
6	AFDB:Q9HCZ1	0.336	0.285	2.948E-48	680	0.490	0.404	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
7	AFDB:Q5MCW4	0.424	0.356	9.792E-48	686	0.439	0.359	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
8	AFDB:A0A024R4S7	0.401	0.296	5.928E-47	792	0.472	0.335	A0A024R4S7.pdb.gz
9	AFDB:P51814	0.434	0.311	8.686E-47	821	0.456	0.312	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
10	AFDB:Q5TYW1	0.465	0.256	1.141E-46	1059	0.517	0.274	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
11	PDB:3w5kB	0.088	0.268	1.051E-4	110	0.077	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.049	0.108	1.322	208	0.062	0.168	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6yxxAf	0.058	0.140	2.282	139	0.041	0.165	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
14	PDB:6o9lQ	0.054	0.066	2.688	430	0.080	0.105	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:5n9jB	0.051	0.157	3.166	133	0.025	0.105	5n9jB.pdb.gz
16	PDB:5c8dE	0.071	0.100	3.729	280	0.036	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:7lbmd	0.062	0.098	3.729	275	0.066	0.135	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
18	PDB:6f40P	0.062	0.092	4.392	246	0.046	0.106	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
19	PDB:4btsA9	0.042	0.136	4.898	93	0.025	0.151	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
20	PDB:7evoC	0.065	0.075	4.898	422	0.055	0.073	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17032	0.0	1152	561	1.000	1.000	ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens OX=9606 GN=ZNF37A PE=2 SV=3
2	Q06732	1.35e-177	522	778	0.567	0.409	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	Q8N184	2.17e-170	499	647	0.522	0.453	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
4	A0A0A0MS50	1.49e-169	496	604	0.517	0.480	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
5	Q96RE9	1.66e-169	495	604	0.517	0.480	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
6	P51523	1.85e-161	479	738	0.497	0.378	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
7	Q8TAQ5	3.88e-160	474	688	0.497	0.406	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
8	Q5MCW4	2.45e-159	472	686	0.501	0.410	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
9	Q9NYW8	7.09e-158	469	714	0.504	0.396	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
10	P17014	2.32e-155	462	697	0.497	0.400	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
11	O94892	5.12e-155	460	652	0.492	0.423	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
12	P51814	7.39e-153	460	821	0.476	0.325	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
13	Q14587	5.37e-152	462	947	0.508	0.301	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
14	P17030	4.45e-150	441	456	0.444	0.546	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
15	Q8NDW4	2.83e-149	443	579	0.487	0.472	ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens OX=9606 GN=ZNF248 PE=1 SV=1
16	Q9BX82	9.05e-149	443	626	0.458	0.411	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
17	A0A0U1RQ46	1.20e-148	442	609	0.449	0.414	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
18	P52742	2.30e-147	441	658	0.467	0.398	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
19	Q9HCZ1	1.32e-146	439	680	0.472	0.390	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
20	Q6PF04	4.27e-146	436	617	0.467	0.425	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.00082	30.9	TFIIH C1-like domain
2	PF01352 KRAB	5.3e-22	88.5	KRAB box
3	PF05458 Siva	38	15.4	Cd27 binding protein (Siva)
4	PF00096 zf-C2H2	1.6e-50	178.0	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	3.6e-27	103.7	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1.5e-09	48.8	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	4.1e-09	47.7	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	1.9e-72	248.0	Zinc-finger double domain
9	PF13909 zf-H2C2_5	5.9	18.0	C2H2-type zinc-finger domain
10	PF17032 zinc_ribbon_15	72	15.6	zinc-ribbon family
11	PF09723 Zn-ribbon_8	7e-06	37.4	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008965783.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.509	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.885	nucleic acid binding
GO:0003677	0.881	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0080090	0.983	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0006355	0.967	regulation of DNA-templated transcription
GO:0048523	0.957	negative regulation of cellular process
GO:0009892	0.926	negative regulation of metabolic process
GO:0010605	0.922	negative regulation of macromolecule metabolic process
GO:0051172	0.667	negative regulation of nitrogen compound metabolic process
GO:0031324	0.608	negative regulation of cellular metabolic process
GO:0009987	0.603	cellular process
GO:0009890	0.580	negative regulation of biosynthetic process
GO:0010558	0.571	negative regulation of macromolecule biosynthetic process
GO:0008152	0.477	metabolic process
GO:0071704	0.451	organic substance metabolic process
GO:0044238	0.438	primary metabolic process
GO:0031327	0.432	negative regulation of cellular biosynthetic process
GO:0045892	0.347	negative regulation of DNA-templated transcription
GO:0044237	0.303	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005654	0.978	nucleoplasm
GO:0043232	0.932	intracellular non-membrane-bounded organelle
GO:0032991	0.918	protein-containing complex
GO:0005576	0.819	extracellular region
GO:0005615	0.796	extracellular space
GO:0043230	0.752	extracellular organelle
GO:0031982	0.752	vesicle
GO:0070062	0.713	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]