StarFunc result for job id P17039

User Input

>input (623 residues)
MAHKYVGLQYHGSVTFEDVAIAFSQQEWESLDSSQRGLYRDVMLENYRNLVSMGHSRSKP
HVIALLEQWKEPEVTVRKDGRRWCTDLQLEDDTIGCKEMPTSENCPSFALHQKISRQKPR
ECQEYGKTLCQDSKPVQHERIHSSEKPNRCKECGKNFSNGHQLTIHQRLHVGEKPYKYEK
CGKAFISGSAFVKHGRIHTGEKPLKCKQCGKTISGSYQLTVHKSIHTGKKPYECGECGKA
FLVYGKLTRHQSTHTGEKPFGCEECGKAFSTFSYLVQHQRIHTSEKPYECKECGKAFSTS
SPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSIHTGEKPFECKECGKAFRLSSFLH
AHQRIHAEIKPYGCKECGRTFSRASYLVQHGRLHTGEKPYECKECGKAFSTGSYLVQHQR
IHTGEKPYECKECGKAFISRHQLTVHQRVHTGEKPYECKECGKAFRVHVHLTQHRKIHTD
VKPYECKECGKTFSRASYLVQHSRIHTGKKPYECKECGKAFSSGSYLVQHQRIHTGEKPY
ECNKCGKAFTVYGQLIGHQSVHTGEKPFECKECGKAFRLNSFLTEHQRVHTGEKPFKCKK
CGKTFRYSSALKVHLRKHMSVIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ECI4	0.623	0.552	2.271E-64	717	0.538	0.467	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
2	AFDB:Q8NDQ6	0.482	0.459	8.092E-64	660	0.543	0.512	Q8NDQ6.pdb.gz	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
3	AFDB:O75290	0.409	0.399	1.112E-63	641	0.531	0.516	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
4	AFDB:Q14587	0.458	0.333	4.178E-63	947	0.517	0.340	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
5	AFDB:P52742	0.575	0.551	5.164E-63	658	0.509	0.482	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
6	AFDB:Q5MCW4	0.444	0.414	5.444E-63	686	0.501	0.455	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
7	AFDB:Q9P2J8	0.451	0.344	1.270E-62	865	0.523	0.377	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
8	AFDB:A6NNF4	0.521	0.452	1.745E-62	738	0.520	0.439	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
9	AFDB:P51523	0.485	0.425	5.899E-62	738	0.514	0.434	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	AFDB:Q8TAQ5	0.519	0.482	6.915E-62	688	0.567	0.513	Q8TAQ5.pdb.gz	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	PDB:3w5kB	0.079	0.249	4.121E-4	110	0.069	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7cunA	0.085	0.077	7.203E-1	730	0.083	0.071	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
13	PDB:7ena4	0.071	0.085	7.594E-1	457	0.082	0.112	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:5c8dE	0.072	0.126	1.434	280	0.030	0.068	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
15	PDB:7dvqM	0.038	0.095	1.681	191	0.051	0.168	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:4oo8D	0.073	0.049	1.772	1163	0.061	0.033	4oo8D.pdb.gz	Crystal structure of Cas9 in complex with guide RNA and target DNA
17	PDB:7uhyC	0.063	0.067	1.772	578	0.051	0.055	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:6vp9B	0.098	0.077	1.868	914	0.091	0.062	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
19	PDB:6hivCv	0.055	0.038	2.077	1059	0.100	0.059	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:6ff4t	0.036	0.099	2.190	172	0.040	0.145	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	535	635	0.461	0.452	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0U1RQ46	592	609	0.486	0.498	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
3	A6NNF4	566	616	0.493	0.498	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	A8K8Y5	545	707	0.469	0.413	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	E9Q981	535	636	0.461	0.451	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
6	K7EK80	529	552	0.470	0.531	K7EK80_HUMAN Zinc finger protein 540 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF540 PE=4 SV=1
7	O75290	662	641	0.546	0.530	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
8	O75437	551	659	0.486	0.460	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
9	P15620	540	580	0.425	0.457	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
10	P15622	529	560	0.456	0.507	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
11	P16373	532	653	0.462	0.441	ZFP59_MOUSE Zinc finger protein 59 OS=Mus musculus OX=10090 GN=Zfp59 PE=1 SV=3
12	P17014	541	697	0.493	0.440	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
13	P17021	558	662	0.483	0.455	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
14	P17027	537	643	0.467	0.453	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
15	P17038	550	809	0.451	0.347	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
16	P35789	592	620	0.501	0.503	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
17	P51523	542	738	0.437	0.369	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
18	P52742	547	658	0.441	0.418	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
19	Q02386	560	682	0.501	0.457	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
20	Q03923	565	595	0.482	0.504	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.6	21.7	TFIIH C1-like domain
2	PF12552 DUF3741	0.044	25.0	Protein of unknown function (DUF3741)
3	PF12961 DUF3850	0.01	27.4	Domain of unknown function (DUF3850)
4	PF19148 DUF5830	2e-08	45.6	Family of unknown function (DUF5830)
5	PF07754 HVO_2753_ZBP	44	15.3	Small zinc finger protein HVO_2753-like, Zn-binding pocket
6	PF01352 KRAB	7.9e-21	84.7	KRAB box
7	PF01286 XPA_N	2.9e-16	70.5	XPA protein N-terminal
8	PF01428 zf-AN1	0.0002	32.7	AN1-like Zinc finger
9	PF00096 zf-C2H2	1.1e-84	285.6	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	1.4e-07	42.4	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	1.4e-44	157.8	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	1.5e-23	93.5	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	7e-18	75.7	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	2.1e-127	421.7	Zinc-finger double domain
15	PF13451 zf-trcl	5.2	18.4	Probable zinc-ribbon domain
16	PF18439 zf_UBZ	6.6e-10	49.8	Ubiquitin-Binding Zinc Finger
17	PF17032 zinc_ribbon_15	5.2e-05	35.3	zinc-ribbon family
18	PF09723 Zn-ribbon_8	1.6e-13	61.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000469876	0.557	Secretoglobin family 2B member 2
2	9606.ENSP00000287652	0.507	Putative deoxyribonuclease TATDN2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.520	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0009889	0.956	regulation of biosynthetic process
GO:0051252	0.939	regulation of RNA metabolic process
GO:0010468	0.929	regulation of gene expression
GO:0010556	0.920	regulation of macromolecule biosynthetic process
GO:0031326	0.918	regulation of cellular biosynthetic process
GO:0006355	0.912	regulation of DNA-templated transcription
GO:0048519	0.908	negative regulation of biological process
GO:0048523	0.891	negative regulation of cellular process
GO:1903507	0.768	negative regulation of nucleic acid-templated transcription
GO:0009987	0.528	cellular process
GO:0050896	0.527	response to stimulus
GO:0045892	0.524	negative regulation of DNA-templated transcription
GO:0008152	0.468	metabolic process
GO:0071704	0.425	organic substance metabolic process
GO:0044238	0.411	primary metabolic process
GO:0006807	0.404	nitrogen compound metabolic process
GO:0043170	0.402	macromolecule metabolic process
GO:0048518	0.326	positive regulation of biological process
GO:0044237	0.326	cellular metabolic process
GO:0006950	0.325	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0005829	0.820	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]