StarFunc result for job id P17040

User Input

>input (1043 residues)
MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEASRQRFRQFQYR
DAAGPHEAFSQLWALCCRWLRPEIRLKEQILELLVLEQFLTILPREVQTWVQARHPESGE
EAVALVEDWHRETRTAGQSGLELHTEETRPLKTGEEAQSFQLQPVDPWPEGQSQKKGVKN
TCPDLPNHLNAEVAPQPLKESAVLTPRVPTLPKMGSVGDWEVTAESQEALGPGKHAEKEL
CKDPPGDDCGNSVCLGVPVSKPSNTSEKEQGPEFWGLSLINSGKRSTADYSLDNEPAQAL
TWRDSRAWEEQYQWDVEDMKVSGVHWGYEETKTFLAILSESPFSEKLRTCHQNRQVYRAI
AEQLRARGFLRTLEQCRYRVKNLLRNYRKAKSSHPPGTCPFYEELEALVRARTAIRATDG
PGEAVALPRLGYSDAEMDEQEEGGWDPEEMAEDCNGAGLVNVESTQGPRIAGAPALFQSR
IAGVHWGYEETKAFLAILSESPFSEKLRTCHQNSQVYRAIAERLCALGFLRTLEQCRYRF
KNLLRSYRKAKSSHPPGTCPFYEELDSLMRARAAVRAMGTVREAAGLPRCGQSSAETDAQ
EAWGEVANEDAVKPSTLCPKAPDMGFEMRHEDEDQISEQDIFEGLPGALSKCPTEAVCQP
LDWGEDSENENEDEGQWGNPSQEQWQESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFS
RSSHFIAHQRIHTGEKPYKCLECGKNFSDRSNLNTHQRIHTGEKPYKCLECGKSFSDHSN
LITHQRIHTGEKPYKCGECWKSFNQSSNLLKHQRIHLGGNPDQCSEPGGNFAQSPSFSAH
WRNSTEETAPEQPQSISKDLNSPGPHSTNSGEKLYECSECGRSFSKSSALISHQRIHTGE
KPYECAECGKSFSKSSTLANHQRTHTGEKPYKCVDCGKCFSERSKLITHQRVHTGEKPYK
CLECGKFFRDRSNLITHQRIHTGEKPYKCRECGKCFNQSSSLIIHQRIHTGEKPYKCTEC
GKDFNNSSHFSAHRRTHAGGKAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17040	1.000	1.000	0.000	1043	1.000	1.000	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
2	AFDB:Q9UJW8	0.245	0.353	5.652E-37	692	0.232	0.350	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
3	AFDB:A0A0A0MS50	0.241	0.388	1.626E-35	604	0.202	0.349	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
4	AFDB:Q6NX49	0.164	0.235	6.166E-35	715	0.226	0.330	Q6NX49.pdb.gz	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
5	AFDB:Q9NQZ8	0.157	0.323	8.050E-35	489	0.198	0.423	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
6	AFDB:Q8TF45	0.223	0.321	9.447E-35	676	0.197	0.303	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
7	AFDB:Q8TBZ5	0.147	0.265	2.217E-34	544	0.206	0.395	Q8TBZ5.pdb.gz	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
8	AFDB:Q7Z3I7	0.227	0.405	2.339E-34	529	0.196	0.386	Q7Z3I7.pdb.gz	ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens OX=9606 GN=ZNF572 PE=1 SV=1
9	AFDB:A2A9J5	0.155	0.245	2.744E-34	645	0.193	0.312	A2A9J5.pdb.gz	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
10	AFDB:Q14587	0.171	0.186	7.558E-34	947	0.201	0.222	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
11	PDB:3w5kB	0.054	0.258	1.430E-3	110	0.038	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2w96A	0.048	0.159	1.389	249	0.012	0.048	2w96A.pdb.gz
13	PDB:7dvqM	0.024	0.088	1.719	191	0.026	0.141	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:5dkaA	0.030	0.169	2.245	96	0.017	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7pntO	0.037	0.090	2.931	197	0.018	0.096	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:6id0L	0.044	0.090	4.036	475	0.049	0.107	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:1b8tA	0.029	0.111	4.490	192	0.027	0.146	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
18	PDB:5gm6a	0.020	0.107	5.269	123	0.023	0.195	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6hivBM	0.054	0.162	6.182	245	0.024	0.102	6hivBM.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:5yzgL	0.042	0.096	6.521	419	0.047	0.117	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17040	0.0	2165	1043	1.000	1.000	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
2	Q8IWY8	0.0	624	852	0.372	0.455	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
3	Q6ZN57	1.54e-131	408	461	0.189	0.427	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
4	P15620	1.52e-129	407	580	0.194	0.348	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
5	Q15937	1.67e-129	404	498	0.190	0.398	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
6	Q9P0L1	6.66e-128	409	754	0.188	0.260	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
7	Q8TBZ5	1.15e-126	398	544	0.191	0.366	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
8	Q9C0F3	3.28e-125	392	470	0.202	0.449	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
9	P17027	3.52e-124	395	643	0.189	0.306	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
10	Q96RE9	3.64e-124	394	604	0.181	0.313	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
11	A0A0A0MS50	4.05e-124	394	604	0.181	0.313	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
12	Q9UJW8	4.93e-124	396	692	0.186	0.280	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
13	Q9NQZ8	5.71e-124	389	489	0.198	0.421	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
14	Q6NX45	6.61e-124	389	483	0.194	0.418	ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens OX=9606 GN=ZNF774 PE=1 SV=2
15	Q9UEG4	1.35e-122	398	869	0.189	0.227	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
16	Q8TAQ5	3.90e-122	391	688	0.186	0.282	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
17	Q9EQB9	4.00e-122	393	759	0.182	0.250	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
18	Q6NX49	4.16e-122	392	715	0.185	0.270	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
19	P17020	4.43e-122	391	682	0.187	0.286	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
20	Q8BLA2	1.59e-121	386	578	0.185	0.334	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13524 Glyco_trans_1_2	2.8e+02	13.3	Glycosyl transferases group 1
2	PF10545 MADF_DNA_bdg	0.86	21.3	Alcohol dehydrogenase transcription factor Myb/SANT-like
3	PF00249 Myb_DNA-binding	2.6e-05	35.6	Myb-like DNA-binding domain
4	PF13837 Myb_DNA-bind_4	1.1e-31	120.3	Myb/SANT-like DNA-binding domain
5	PF13921 Myb_DNA-bind_6	2.9	19.5	Myb-like DNA-binding domain
6	PF02023 SCAN	2.2e-37	138.1	SCAN domain
7	PF01286 XPA_N	75	14.8	XPA protein N-terminal
8	PF00096 zf-C2H2	4.9e-57	198.5	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	3.1e-05	34.9	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	1.9e-25	98.3	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	0.0031	28.7	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	1.8e-12	58.4	Zinc-finger double-stranded RNA-binding
13	PF13465 zf-H2C2_2	1.3e-63	220.0	Zinc-finger double domain
14	PF17032 zinc_ribbon_15	7.4e+02	12.3	zinc-ribbon family
15	PF09723 Zn-ribbon_8	0.0017	29.7	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302310	0.858	Zinc finger protein 396
2	9606.ENSP00000363103	0.838	SCAN domain-containing protein 1
3	9606.ENSP00000380057	0.746	Zinc finger and SCAN domain-containing protein 32
4	9606.ENSP00000259883	0.734	PiggyBac transposable element-derived protein 1
5	9606.ENSP00000366509	0.733	Zinc finger protein with KRAB and SCAN domains 4
6	9606.ENSP00000331577	0.713	Zinc finger protein 397
7	9606.ENSP00000395259	0.707	SCAN domain-containing protein 3
8	9606.ENSP00000304437	0.701	Protein very KIND
9	9606.ENSP00000366465	0.699	Zinc finger protein with KRAB and SCAN domains 3
10	9606.ENSP00000250076	0.698	Zinc finger protein 232
11	9606.ENSP00000292450	0.697	Zinc finger and SCAN domain-containing protein 21
12	9606.ENSP00000379370	0.697	Zinc finger protein 197
13	9606.ENSP00000268655	0.692	Zinc finger protein 174
14	9606.ENSP00000289788	0.690	Zinc finger and SCAN domain-containing protein 23
15	9606.ENSP00000332750	0.690	Zinc finger protein with KRAB and SCAN domains 8
16	9606.ENSP00000380087	0.690	Zinc finger protein 213
17	9606.ENSP00000392371	0.690	Zinc finger and SCAN domain-containing protein 30
18	9606.ENSP00000470123	0.690	Zinc finger and SCAN domain-containing protein 18
19	9606.ENSP00000332433	0.689	Zinc finger and SCAN domain-containing protein 22
20	9606.ENSP00000360829	0.689	Belongs to the glycosyltransferase 6 family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.798	heterocyclic compound binding
GO:0097159	0.798	organic cyclic compound binding
GO:0003676	0.781	nucleic acid binding
GO:0003677	0.760	DNA binding
GO:0003690	0.629	double-stranded DNA binding
GO:0042802	0.619	identical protein binding
GO:1990837	0.612	sequence-specific double-stranded DNA binding
GO:0140110	0.515	transcription regulator activity
GO:0003700	0.491	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0048519	0.956	negative regulation of biological process
GO:0009892	0.951	negative regulation of metabolic process
GO:0048523	0.937	negative regulation of cellular process
GO:0010605	0.933	negative regulation of macromolecule metabolic process
GO:0051172	0.928	negative regulation of nitrogen compound metabolic process
GO:0045892	0.915	negative regulation of DNA-templated transcription
GO:0006357	0.879	regulation of transcription by RNA polymerase II
GO:0048518	0.800	positive regulation of biological process
GO:0048522	0.654	positive regulation of cellular process
GO:0009893	0.384	positive regulation of metabolic process
GO:0000122	0.372	negative regulation of transcription by RNA polymerase II
GO:0009987	0.344	cellular process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.966	intracellular organelle lumen
GO:0031981	0.914	nuclear lumen
GO:0005654	0.746	nucleoplasm
GO:0005737	0.625	cytoplasm
GO:0005829	0.545	cytosol
GO:0016020	0.374	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]