StarFunc result for job id P17041

User Input

>input (273 residues)
MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSP
DSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNL
VTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHR
RVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHT
GETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17041	1.000	1.000	5.633E-50	273	1.000	1.000	P17041.pdb.gz	ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens OX=9606 GN=ZNF32 PE=1 SV=2
2	AFDB:Q8CIP9	0.655	0.659	5.541E-26	271	0.381	0.384	Q8CIP9.pdb.gz	Q8CIP9_MOUSE KRAB zinc finger protein 6D (Fragment) OS=Mus musculus OX=10090 GN=Zfp640 PE=2 SV=1
3	AFDB:Q9NQZ8	0.619	0.366	6.256E-26	489	0.399	0.223	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
4	AFDB:Q9JIC0	0.638	0.332	1.080E-25	545	0.429	0.215	Q9JIC0.pdb.gz	Q9JIC0_MOUSE KRAB zinc finger protein OS=Mus musculus OX=10090 GN=Zfp119a PE=2 SV=1
5	AFDB:Q86W11	0.643	0.372	1.555E-25	494	0.399	0.221	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
6	AFDB:Q8TF45	0.636	0.275	2.239E-25	676	0.414	0.167	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
7	AFDB:Q8TBZ5	0.682	0.353	2.528E-25	544	0.407	0.204	Q8TBZ5.pdb.gz	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
8	AFDB:Q86UD4	0.653	0.342	3.638E-25	541	0.418	0.211	Q86UD4.pdb.gz	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
9	AFDB:Q8N184	0.645	0.286	3.638E-25	647	0.392	0.165	Q8N184.pdb.gz	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
10	AFDB:Q6ZN57	0.623	0.386	3.866E-25	461	0.429	0.254	Q6ZN57.pdb.gz	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
11	PDB:3w5kB	0.142	0.253	1.055E-4	110	0.154	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.061	0.202	8.946E-1	62	0.055	0.242	6ydhA.pdb.gz
13	PDB:4fjcE	0.090	0.067	1.140	434	0.081	0.051	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:7ungi	0.098	0.105	1.545	250	0.084	0.092	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:5a31B	0.060	0.130	1.744	84	0.051	0.167	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:7cunA	0.107	0.059	1.970	730	0.095	0.036	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
17	PDB:6vvvC	0.092	0.047	2.511	790	0.055	0.019	6vvvC.pdb.gz	The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
18	PDB:7od1A	0.089	0.066	2.511	430	0.077	0.049	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:7uhyD	0.070	0.067	2.511	288	0.077	0.073	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:5c8dE	0.131	0.128	2.668	280	0.081	0.079	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17041	0.0	564	273	1.000	1.000	ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens OX=9606 GN=ZNF32 PE=1 SV=2
2	A0A0A0MS50	1.70e-76	245	604	0.396	0.179	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
3	Q96RE9	1.74e-76	245	604	0.396	0.179	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
4	Q8N184	2.17e-76	246	647	0.414	0.175	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
5	Q6P2D0	2.28e-75	237	407	0.370	0.248	ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens OX=9606 GN=ZFP1 PE=1 SV=2
6	Q6ZN57	1.49e-74	236	461	0.436	0.258	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
7	Q15072	1.99e-74	231	292	0.377	0.353	OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens OX=9606 GN=ZNF146 PE=1 SV=2
8	Q15776	4.06e-74	238	578	0.388	0.183	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
9	Q8TF45	1.21e-73	239	676	0.414	0.167	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
10	Q6NX49	3.47e-73	239	715	0.396	0.151	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
11	P51523	4.96e-73	239	738	0.388	0.144	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
12	Q3SY52	1.17e-72	232	487	0.399	0.224	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
13	Q5MCW4	1.21e-72	237	686	0.396	0.157	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
14	Q9NQZ8	1.42e-72	232	489	0.392	0.219	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
15	Q9UJW8	2.10e-72	236	692	0.388	0.153	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
16	Q969W8	3.19e-72	229	418	0.381	0.249	ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens OX=9606 GN=ZNF566 PE=1 SV=1
17	P15620	3.39e-72	233	580	0.385	0.181	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
18	Q86UD4	6.58e-72	231	541	0.425	0.214	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
19	Q15937	7.24e-72	230	498	0.374	0.205	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
20	Q9BX82	9.94e-72	233	626	0.388	0.169	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.01	27.0	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF07975 C1_4	2.2e-05	35.9	TFIIH C1-like domain
3	PF14353 CpXC	32	16.0	CpXC protein
4	PF03604 DNA_RNApol_7kD	3.9	18.6	DNA directed RNA polymerase, 7 kDa subunit
5	PF10013 DUF2256	9.9e+02	11.3	Uncharacterized protein conserved in bacteria (DUF2256)
6	PF19148 DUF5830	5.7e+02	11.9	Family of unknown function (DUF5830)
7	PF00412 LIM	1.6e+02	13.9	LIM domain
8	PF01286 XPA_N	9.5e+02	11.3	XPA protein N-terminal
9	PF01428 zf-AN1	0.12	23.9	AN1-like Zinc finger
10	PF00096 zf-C2H2	1.3e-39	143.6	Zinc finger, C2H2 type
11	PF16622 zf-C2H2_11	0.0014	29.6	zinc-finger C2H2-type
12	PF13894 zf-C2H2_4	9.4e-23	89.9	C2H2-type zinc finger
13	PF13912 zf-C2H2_6	9.9e-12	55.8	C2H2-type zinc finger
14	PF12171 zf-C2H2_jaz	3.5e-08	44.7	Zinc-finger double-stranded RNA-binding
15	PF13913 zf-C2HC_2	0.049	24.8	zinc-finger of a C2HC-type
16	PF13465 zf-H2C2_2	2e-48	171.9	Zinc-finger double domain
17	PF13909 zf-H2C2_5	1.2e+02	13.9	C2H2-type zinc-finger domain
18	PF08790 zf-LYAR	52	15.1	LYAR-type C2HC zinc finger
19	PF12874 zf-met	51	15.7	Zinc-finger of C2H2 type
20	PF18439 zf_UBZ	0.002	29.0	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019285

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015644	0.691	FRA10A associated CGG repeat 1
2	61853.ENSNLEP00000008726	0.523	Yes-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.963	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0019222	0.968	regulation of metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0019219	0.830	regulation of nucleobase-containing compound metabolic process
GO:1903506	0.715	regulation of nucleic acid-templated transcription
GO:0006355	0.704	regulation of DNA-templated transcription
GO:0009987	0.690	cellular process
GO:0048523	0.618	negative regulation of cellular process
GO:0031324	0.575	negative regulation of cellular metabolic process
GO:0051172	0.573	negative regulation of nitrogen compound metabolic process
GO:0010605	0.569	negative regulation of macromolecule metabolic process
GO:0045934	0.423	negative regulation of nucleobase-containing compound metabolic process
GO:0048518	0.355	positive regulation of biological process
GO:0010558	0.353	negative regulation of macromolecule biosynthetic process
GO:0050896	0.344	response to stimulus
GO:0031327	0.338	negative regulation of cellular biosynthetic process
GO:1903507	0.325	negative regulation of nucleic acid-templated transcription
GO:0045892	0.323	negative regulation of DNA-templated transcription
GO:0048522	0.313	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.620	nuclear lumen
GO:0005654	0.573	nucleoplasm
GO:0032991	0.436	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]