StarFunc result for job id P17050

User Input

>input (411 residues)
MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMAD
RMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA
DMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATG
RPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQ
PVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNP
LMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNF
TGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17050	1.000	1.000	1.081E-92	411	1.000	1.000	P17050.pdb.gz	NAGAB_HUMAN Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX=9606 GN=NAGA PE=1 SV=2
2	PDB:4do4B	0.958	0.984	1.180E-86	400	0.956	0.983	4do4B.pdb.gz	Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
3	AFDB:D3ZJF9	0.891	0.872	2.079E-56	420	0.499	0.488	D3ZJF9.pdb.gz	D3ZJF9_RAT Alpha-galactosidase OS=Rattus norvegicus OX=10116 GN=Gla PE=3 SV=3
4	AFDB:P06280	0.913	0.875	5.001E-56	429	0.479	0.459	P06280.pdb.gz	AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1
5	PDB:3lxbB	0.920	0.954	5.937E-54	396	0.479	0.497	3lxbB.pdb.gz
6	AFDB:Q21801	0.927	0.846	2.071E-53	451	0.426	0.388	Q21801.pdb.gz	Q21801_CAEEL Alpha-galactosidase OS=Caenorhabditis elegans OX=6239 GN=gana-1 PE=1 SV=1
7	AFDB:Q8VXZ7	0.836	0.788	3.407E-46	437	0.367	0.346	Q8VXZ7.pdb.gz	AGAL3_ARATH Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1
8	AFDB:Q8RX86	0.834	0.865	1.971E-45	396	0.358	0.371	Q8RX86.pdb.gz	AGAL2_ARATH Alpha-galactosidase 2 OS=Arabidopsis thaliana OX=3702 GN=AGAL2 PE=1 SV=1
9	AFDB:Q9FT97	0.830	0.832	8.510E-45	410	0.358	0.359	Q9FT97.pdb.gz	AGAL1_ARATH Alpha-galactosidase 1 OS=Arabidopsis thaliana OX=3702 GN=AGAL1 PE=2 SV=1
10	PDB:1uasA	0.826	0.935	5.111E-44	362	0.341	0.387	1uasA.pdb.gz	Crystal structure of rice alpha-galactosidase complexed with D-galactose
11	AFDB:Q9FXT4	0.829	0.817	8.334E-44	417	0.348	0.343	Q9FXT4.pdb.gz	AGAL_ORYSJ Alpha-galactosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os10g0493600 PE=1 SV=1
12	AFDB:B3PGJ1	0.825	0.839	3.135E-42	404	0.360	0.366	B3PGJ1.pdb.gz	AGAL_CELJU Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agaA PE=1 SV=1
13	AFDB:A2QL72	0.851	0.659	8.987E-42	537	0.324	0.248	A2QL72.pdb.gz	AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=aglA PE=3 SV=1
14	PDB:1sznA	0.804	0.792	8.203E-33	417	0.277	0.273	1sznA.pdb.gz	Crystal structure of alpha-galactosidase from Trichoderma reesei and its complex with galactose: implications for catalytic mechanism.
15	PDB:2xn2A	0.617	0.372	2.951E-12	729	0.165	0.093	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
16	PDB:5m1iA	0.526	0.411	3.129E-12	539	0.109	0.083	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.
17	PDB:4fnsA	0.639	0.385	4.893E-11	718	0.141	0.081	4fnsA.pdb.gz	The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
18	PDB:1j0hA	0.554	0.403	8.784E-11	588	0.109	0.077	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
19	PDB:2d73A	0.527	0.333	4.793E-10	717	0.124	0.071	2d73A.pdb.gz	Structural and functional analysis of a glycoside hydrolase family 97 enzyme from Bacteroides thetaiotaomicron.
20	PDB:5bxaA	0.489	0.487	1.153E-9	414	0.134	0.133	5bxaA.pdb.gz	Characterization of the Pseudomonas aeruginosa Glycoside Hydrolase PslG Reveals That Its Levels Are Critical for Psl Polysaccharide Biosynthesis and Biofilm Formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17050	0.0	854	411	1.000	1.000	NAGAB_HUMAN Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX=9606 GN=NAGA PE=1 SV=2
2	D3ZJF9	1.23e-126	374	421	0.511	0.499	D3ZJF9_RAT Alpha-galactosidase OS=Rattus norvegicus OX=10116 GN=Gla PE=3 SV=3
3	P51569	2.72e-126	373	419	0.518	0.508	AGAL_MOUSE Alpha-galactosidase A OS=Mus musculus OX=10090 GN=Gla PE=1 SV=1
4	P06280	1.12e-121	361	429	0.477	0.457	AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1
5	Q21801	2.28e-103	315	451	0.431	0.392	Q21801_CAEEL Alpha-galactosidase OS=Caenorhabditis elegans OX=6239 GN=gana-1 PE=1 SV=1
6	Q8VXZ7	3.52e-85	268	437	0.358	0.336	AGAL3_ARATH Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1
7	Q8RX86	6.77e-81	256	396	0.360	0.374	AGAL2_ARATH Alpha-galactosidase 2 OS=Arabidopsis thaliana OX=3702 GN=AGAL2 PE=1 SV=1
8	Q9FXT4	8.07e-79	251	417	0.350	0.345	AGAL_ORYSJ Alpha-galactosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os10g0493600 PE=1 SV=1
9	Q9FT97	5.79e-78	249	410	0.353	0.354	AGAL1_ARATH Alpha-galactosidase 1 OS=Arabidopsis thaliana OX=3702 GN=AGAL1 PE=2 SV=1
10	B3PGJ1	1.31e-72	234	404	0.355	0.361	AGAL_CELJU Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agaA PE=1 SV=1
11	A2QL72	3.08e-58	201	537	0.328	0.251	AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=aglA PE=3 SV=1
12	Q9URZ0	3.07e-49	174	436	0.275	0.259	AGAL_SCHPO Alpha-galactosidase mel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mel1 PE=3 SV=1
13	Q5AX28	9.16e-42	158	659	0.294	0.184	AGALD_EMENI Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2
14	Q92456	1.26e-41	154	444	0.270	0.250	Q92456_HYPJE Alpha-galactosidase OS=Hypocrea jecorina OX=51453 GN=agl1 PE=1 SV=1
15	F4JCI4	2.70e-15	80.1	647	0.219	0.139	F4JCI4_ARATH Alpha-galactosidase OS=Arabidopsis thaliana OX=3702 GN=APSE PE=1 SV=1
16	G1UB44	2.48e-04	45.8	732	0.054	0.030	MELA_LACAC Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
17	Q92451	0.006	41.2	624	0.114	0.075	AGAL3_HYPJE Alpha-galactosidase 3 OS=Hypocrea jecorina OX=51453 GN=agl3 PE=1 SV=1
18	Q9ALJ4	0.24	36.2	729	0.044	0.025	AGAA_GEOSE Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
19	P11125	0.34	35.4	332	0.054	0.066	P4_BPPH6 Packaging enzyme P4 OS=Pseudomonas phage phi6 OX=2928686 GN=P4 PE=1 SV=3
20	Q7JYV7	1.8	32.3	175	0.036	0.086	KAD6_DROME Adenylate kinase isoenzyme 6 homolog OS=Drosophila melanogaster OX=7227 GN=Ak6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02065 Melibiase	1.3	19.5	Melibiase
2	PF16499 Melibiase_2	5e-140	477.2	Alpha galactosidase A
3	PF17450 Melibiase_2_C	1.6e-13	62.0	Alpha galactosidase A C-terminal beta sandwich domain
4	PF17801 Melibiase_C	0.025	25.9	Alpha galactosidase C-terminal beta sandwich domain
5	PF12188 STAT2_C	5.7e+02	11.9	Signal transducer and activator of transcription 2 C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379680

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268097	0.963	Beta-hexosaminidase subunit alpha
2	9606.ENSP00000261416	0.958	Beta-hexosaminidase subunit beta
3	9606.ENSP00000376532	0.954	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
4	9606.ENSP00000381699	0.900	Beta-1,3-galactosyltransferase 5
5	9606.ENSP00000361110	0.875	Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
6	9606.ENSP00000306920	0.747	Beta-galactosidase
7	9606.ENSP00000354850	0.739	Protein O-GlcNAcase
8	9606.ENSP00000002165	0.719	Plasma alpha-L-fucosidase
9	9606.ENSP00000269980	0.717	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
10	9606.ENSP00000435373	0.688	Cyclin-J
11	9606.ENSP00000457788	0.688	Alpha-mannosidase 2C1
12	9606.ENSP00000216254	0.671	Aconitate hydratase, mitochondrial
13	9606.ENSP00000363603	0.670	Tissue alpha-L-fucosidase
14	9606.ENSP00000210444	0.666	Sialic acid synthase
15	9606.ENSP00000346839	0.660	Fibronectin type III domain containing
16	9606.ENSP00000395473	0.654	Lysosomal alpha-mannosidase
17	9606.ENSP00000317214	0.646	Calpain-6
18	9606.ENSP00000443246	0.642	Uncharacterized protein
19	9606.ENSP00000000412	0.641	Cation-dependent mannose-6-phosphate receptor
20	9606.ENSP00000233840	0.633	Sialidase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0004557	1.000	alpha-galactosidase activity
GO:0015929	0.999	hexosaminidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0006664	0.990	glycolipid metabolic process
GO:1901136	0.988	carbohydrate derivative catabolic process
GO:0044242	0.987	cellular lipid catabolic process
GO:0046466	0.959	membrane lipid catabolic process
GO:0005975	0.911	carbohydrate metabolic process
GO:0006807	0.619	nitrogen compound metabolic process
GO:1901564	0.553	organonitrogen compound metabolic process
GO:0016052	0.414	carbohydrate catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0031982	0.998	vesicle
GO:0070062	0.987	extracellular exosome
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0070013	0.951	intracellular organelle lumen
GO:0012505	0.949	endomembrane system
GO:0005773	0.706	vacuole
GO:0005764	0.684	lysosome
GO:0030141	0.495	secretory granule
GO:0042582	0.470	azurophil granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28663	1.000	H2O + melibiose = D-galactose + D-glucose
EC:3.2.1.22	1.000	alpha-galactosidase.

[back to server]