StarFunc result for job id P17066

User Input

>input (643 residues)
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16627	0.963	0.965	0.000	641	0.790	0.793	P16627.pdb.gz	HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus OX=10090 GN=Hspa1l PE=1 SV=4
2	AFDB:P17066	1.000	1.000	0.000	643	1.000	1.000	P17066.pdb.gz	HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2
3	AFDB:Q59EJ3	0.966	0.877	0.000	709	0.813	0.738	Q59EJ3.pdb.gz	Q59EJ3_HUMAN Heat shock 70kDa protein 1A variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:Q5KT34	0.950	0.948	1.169E-103	644	0.784	0.783	Q5KT34.pdb.gz	Q5KT34_ONCMY Heat shock 70kDa protein OS=Oncorhynchus mykiss OX=8022 GN=HSP70b PE=2 SV=1
5	AFDB:P08108	0.965	0.953	1.298E-103	651	0.764	0.754	P08108.pdb.gz	HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss OX=8022 GN=hsc71 PE=2 SV=2
6	AFDB:P54652	0.964	0.969	1.298E-103	639	0.781	0.786	P54652.pdb.gz	HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1
7	AFDB:P27541	0.959	0.958	2.654E-103	644	0.770	0.769	P27541.pdb.gz	HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi OX=6279 GN=HSP70 PE=3 SV=1
8	AFDB:P11147	0.955	0.943	7.025E-103	651	0.776	0.767	P11147.pdb.gz	HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster OX=7227 GN=Hsc70-4 PE=1 SV=3
9	AFDB:Q9IAC1	0.962	0.940	1.685E-101	658	0.778	0.760	Q9IAC1.pdb.gz
10	AFDB:P36415	0.950	0.954	8.684E-101	640	0.717	0.720	P36415.pdb.gz	HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum OX=44689 GN=hspB PE=1 SV=2
11	PDB:6asyA	0.875	0.926	2.452E-80	606	0.583	0.619	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
12	PDB:7kw7C	0.567	0.706	2.132E-76	511	0.695	0.875	7kw7C.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:7krwA	0.655	0.690	1.575E-60	608	0.468	0.495	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
14	PDB:5fpnA	0.535	0.872	8.147E-59	379	0.496	0.842	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
15	PDB:2qxlB	0.811	0.833	9.770E-51	625	0.252	0.259	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
16	PDB:3c7nA	0.803	0.796	6.575E-47	649	0.258	0.256	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
17	PDB:6sr6C	0.553	0.669	1.759E-43	524	0.212	0.260	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
18	PDB:7x3kB	0.553	0.693	5.179E-42	506	0.238	0.302	7x3kB.pdb.gz
19	PDB:6w6eI	0.499	0.869	1.072E-38	357	0.281	0.507	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	PDB:1jcfA	0.419	0.758	2.767E-16	336	0.138	0.265	1jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0H3L5C8	528	625	0.471	0.485	A0A0H3L5C8_MYCTE Chaperone protein DnaK OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=dnaK PE=2 SV=1
2	A0A1D5PFJ6	1052	638	0.756	0.762	A0A1D5PFJ6_CHICK Heat shock 70kDa protein 8 OS=Gallus gallus OX=9031 GN=HSPA8 PE=1 SV=2
3	A0A1D8PG96	769	687	0.580	0.543	A0A1D8PG96_CANAL Endoplasmic reticulum chaperone BiP OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KAR2 PE=3 SV=1
4	A0A384P5G6	587	679	0.485	0.459	A0A384P5G6_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
5	A0A509AJG0	771	651	0.565	0.558	BIP_PLABA Endoplasmic reticulum chaperone BIP OS=Plasmodium berghei (strain Anka) OX=5823 GN=BIP PE=1 SV=1
6	A0PA16	1052	646	0.756	0.752	A0PA16_COTJA Heat shock protein 70kDa OS=Coturnix japonica OX=93934 GN=HSPA8 PE=2 SV=1
7	A0QQC8	541	622	0.465	0.481	DNAK_MYCS2 Chaperone protein DnaK OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=dnaK PE=1 SV=1
8	A1A766	558	638	0.474	0.478	DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC OX=405955 GN=dnaK PE=3 SV=1
9	A1KFH2	528	625	0.471	0.485	DNAK_MYCBP Chaperone protein DnaK OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=dnaK PE=1 SV=1
10	A5I640	546	623	0.462	0.477	DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=dnaK PE=3 SV=1
11	A8WFS0	1077	643	0.785	0.785	A8WFS0_DANRE Heat shock cognate 70-kd protein, like OS=Danio rerio OX=7955 GN=LOC560210 PE=2 SV=1
12	B0UXS6	1081	643	0.788	0.788	B0UXS6_DANRE Heat shock 70 kDa protein isoform X2 OS=Danio rerio OX=7955 GN=zgc:174006 PE=2 SV=1
13	B3VHV2	1037	634	0.750	0.760	B3VHV2_CHICK Heat shock protein 70 OS=Gallus gallus OX=9031 GN=HSP70 PE=2 SV=1
14	B5X397	790	657	0.591	0.578	B5X397_SALSA 78 kDa glucose-regulated protein OS=Salmo salar OX=8030 GN=GRP78 PE=2 SV=1
15	B6EAX2	1046	634	0.753	0.763	B6EAX2_CHICK Heat shock protein 70 OS=Gallus gallus OX=9031 GN=HSP70 PE=2 SV=1
16	B9RYP6	825	664	0.608	0.589	B9RYP6_RICCO Heat shock protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1312280 PE=3 SV=1
17	C8Z3H3	913	634	0.683	0.692	C8Z3H3_YEAS8 Ssa1p OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=EC1118_1A20_0804g PE=1 SV=1
18	D6RCD7	585	665	0.485	0.469	D6RCD7_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2
19	G3I8R9	800	654	0.603	0.593	BIP_CRIGR Endoplasmic reticulum chaperone BiP OS=Cricetulus griseus OX=10029 GN=HSPA5 PE=1 SV=1
20	G4NAY4	665	614	0.538	0.564	SSB1_MAGO7 Heat shock protein SSB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=SSB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07318 DUF1464	2e+02	12.5	Protein of unknown function (DUF1464)
2	PF02782 FGGY_C	3.8	18.8	FGGY family of carbohydrate kinases, C-terminal domain
3	PF14450 FtsA	8.7	18.2	Cell division protein FtsA
4	PF00012 HSP70	1.6e-257	867.2	Hsp70 protein
5	PF01968 Hydantoinase_A	59	14.4	Hydantoinase/oxoprolinase
6	PF06723 MreB_Mbl	2.7e-13	61.1	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254322	0.990	DnaJ homolog subfamily B member 1
2	9606.ENSP00000262177	0.983	DnaJ homolog subfamily B member 6
3	9606.ENSP00000358081	0.968	BAG family molecular chaperone regulator 3
4	9606.ENSP00000368565	0.953	DnaJ homolog subfamily C member 2
5	9606.ENSP00000318687	0.943	Heat shock protein 105 kDa
6	9606.ENSP00000359727	0.942	BAG family molecular chaperone regulator 2
7	9606.ENSP00000406463	0.934	DnaJ homolog subfamily C member 7
8	9606.ENSP00000338814	0.932	BAG family molecular chaperone regulator 5
9	9606.ENSP00000420514	0.931	BAG family molecular chaperone regulator 1
10	9606.ENSP00000283195	0.928	E3 SUMO-protein ligase RanBP2
11	9606.ENSP00000287322	0.928	BAG family molecular chaperone regulator 4
12	9606.ENSP00000216218	0.925	Hsc70-interacting protein
13	9606.ENSP00000448054	0.923	Nucleoporin Nup37
14	9606.ENSP00000316032	0.921	Nuclear pore complex protein Nup98-Nup96
15	9606.ENSP00000373312	0.920	Protein SEC13 homolog
16	9606.ENSP00000379182	0.915	mRNA export factor
17	9606.ENSP00000444029	0.914	Nuclear pore complex protein Nup153
18	9606.ENSP00000310668	0.912	Nuclear pore complex protein Nup93
19	9606.ENSP00000264883	0.911	Nucleoporin p54
20	9606.ENSP00000342262	0.909	Nucleoporin Nup43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051082	0.826	unfolded protein binding
GO:1901363	0.727	heterocyclic compound binding
GO:0097159	0.724	organic cyclic compound binding
GO:0003824	0.619	catalytic activity
GO:0016787	0.479	hydrolase activity
GO:0017111	0.326	ribonucleoside triphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.982	response to stimulus
GO:0006950	0.970	response to stress
GO:0009266	0.833	response to temperature stimulus
GO:0051716	0.749	cellular response to stimulus
GO:0009408	0.726	response to heat
GO:0006457	0.718	protein folding
GO:0033554	0.702	cellular response to stress
GO:0065007	0.547	biological regulation
GO:0042221	0.516	response to chemical
GO:0050789	0.504	regulation of biological process
GO:0050794	0.490	regulation of cellular process
GO:0008152	0.406	metabolic process
GO:0010033	0.376	response to organic substance
GO:0071704	0.330	organic substance metabolic process
GO:0006986	0.324	response to unfolded protein
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0032991	0.996	protein-containing complex
GO:0070013	0.996	intracellular organelle lumen
GO:0005829	0.995	cytosol
GO:0005634	0.994	nucleus
GO:0012505	0.992	endomembrane system
GO:0005576	0.983	extracellular region
GO:0031982	0.980	vesicle
GO:0070062	0.968	extracellular exosome
GO:0031981	0.917	nuclear lumen
GO:0043228	0.896	non-membrane-bounded organelle
GO:0043232	0.886	intracellular non-membrane-bounded organelle
GO:0005654	0.843	nucleoplasm
GO:0016020	0.792	membrane
GO:0140513	0.730	nuclear protein-containing complex
GO:0072562	0.340	blood microparticle
GO:0031410	0.333	cytoplasmic vesicle
GO:0099503	0.302	secretory vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.479	Hydrolases.
RHEA:23680	0.326	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.326	nucleoside-triphosphate phosphatase.

[back to server]