StarFunc result for job id P17081

User Input

>input (205 residues)
MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLG
LYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIG
TQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAII
AILTPKKHTVKKRIGSRCINCCLIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17081	1.000	1.000	3.426E-41	205	1.000	1.000	P17081.pdb.gz	RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens OX=9606 GN=RHOQ PE=1 SV=2
2	AFDB:Q9ER71	0.877	0.840	1.080E-33	214	0.756	0.724	Q9ER71.pdb.gz	RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus OX=10090 GN=Rhoj PE=1 SV=2
3	PDB:2atxA	0.859	0.945	1.462E-32	186	0.893	0.984	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
4	AFDB:P0CY33	0.879	0.943	1.057E-31	191	0.585	0.628	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
5	AFDB:P40793	0.880	0.944	1.447E-31	191	0.624	0.670	P40793.pdb.gz	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
6	AFDB:Q01112	0.866	0.924	5.081E-31	192	0.595	0.635	Q01112.pdb.gz	CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc42 PE=1 SV=1
7	AFDB:Q05062	0.881	0.945	7.885E-31	191	0.610	0.654	Q05062.pdb.gz	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
8	AFDB:P19073	0.880	0.944	1.149E-30	191	0.576	0.618	P19073.pdb.gz	CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC42 PE=1 SV=2
9	AFDB:A2BHI1	0.868	0.813	1.388E-30	219	0.585	0.548	A2BHI1.pdb.gz
10	AFDB:P40792	0.871	0.929	2.948E-30	192	0.580	0.620	P40792.pdb.gz	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
11	AFDB:A0JC80	0.892	0.918	3.342E-30	199	0.576	0.593	A0JC80.pdb.gz	A0JC80_9HYPO RacA OS=Epichloe festucae OX=35717 GN=racA PE=2 SV=1
12	PDB:2wkpA	0.855	0.550	2.040E-28	320	0.561	0.359	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:1nf3A	0.870	0.919	3.372E-28	194	0.605	0.639	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
14	PDB:6hxuA	0.861	0.968	3.300E-26	182	0.459	0.516	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
15	PDB:5c2kA	0.854	0.461	8.462E-26	382	0.468	0.251	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:4mitC	0.856	0.968	2.038E-25	181	0.454	0.514	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
17	PDB:6jikA	0.849	0.954	8.638E-25	182	0.449	0.505	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
18	PDB:6ukaA	0.836	0.966	8.638E-25	177	0.488	0.565	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
19	PDB:3a58F	0.851	0.961	3.296E-23	181	0.429	0.486	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
20	PDB:2j0vB	0.807	0.893	4.415E-21	184	0.459	0.511	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17081	2.17e-153	424	205	1.000	1.000	RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens OX=9606 GN=RHOQ PE=1 SV=2
2	V9HWD0	2.17e-153	424	205	1.000	1.000	V9HWD0_HUMAN Epididymis secretory protein Li 42 OS=Homo sapiens OX=9606 GN=HEL-S-42 PE=1 SV=1
3	Q8R527	4.74e-153	424	205	0.995	0.995	RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus OX=10090 GN=Rhoq PE=1 SV=2
4	Q9JJL4	4.74e-153	424	205	0.995	0.995	RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus OX=10116 GN=Rhoq PE=2 SV=1
5	Q9H4E5	3.79e-109	313	214	0.761	0.729	RHOJ_HUMAN Rho-related GTP-binding protein RhoJ OS=Homo sapiens OX=9606 GN=RHOJ PE=1 SV=1
6	Q9ER71	3.45e-105	303	214	0.717	0.687	RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus OX=10090 GN=Rhoj PE=1 SV=2
7	P40793	1.41e-93	273	191	0.624	0.670	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
8	Q6PFU4	2.38e-92	270	191	0.610	0.654	Q6PFU4_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
9	P60766	2.68e-92	270	191	0.610	0.654	CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus OX=10090 GN=Cdc42 PE=1 SV=2
10	P60953	2.68e-92	270	191	0.610	0.654	CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2
11	Q8CFN2	2.68e-92	270	191	0.610	0.654	CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2
12	Q52WY2	5.11e-92	269	191	0.615	0.660	Q52WY2_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
13	Q05062	7.50e-92	268	191	0.610	0.654	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
14	Q01112	3.84e-88	259	192	0.595	0.635	CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc42 PE=1 SV=1
15	Q4WWL5	1.32e-87	258	199	0.585	0.603	Q4WWL5_ASPFU Rho GTPase Rac, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06300 PE=4 SV=1
16	A9JRY8	2.36e-87	257	192	0.610	0.651	A9JRY8_DANRE Rac family small GTPase 3b OS=Danio rerio OX=7955 GN=rac3b PE=1 SV=1
17	P0CY33	7.70e-87	256	191	0.580	0.623	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
18	Q5DR84	6.92e-86	254	199	0.580	0.598	Q5DR84_ASPNG CorA-like Mg2+ transporter family protein OS=Aspergillus niger OX=5061 GN=AnigIFM60653_002925 PE=4 SV=1
19	P19073	1.82e-85	252	191	0.571	0.613	CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC42 PE=1 SV=2
20	P62998	2.73e-85	252	192	0.580	0.620	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	0.0016	29.4	ADP-ribosylation factor family
2	PF00009 GTP_EFTU	1.8e+02	13.0	Elongation factor Tu GTP binding domain
3	PF00071 Ras	1.8e-47	172.4	Ras family
4	PF08477 Roc	9e-16	69.6	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008821284.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008829577.1	0.985	Exocyst complex component 7
2	1026970.XP_008842247.1	0.960	Rap guanine nucleotide exchange factor 1
3	1026970.XP_008826989.1	0.950	CRK proto-oncogene, adaptor protein
4	1026970.XP_008840462.1	0.913	CRK like proto-oncogene, adaptor protein
5	1026970.XP_008834007.1	0.893	Golgi-associated PDZ and coiled-coil motif-containing protein isoform X1
6	1026970.XP_008833381.1	0.870	Par-6 family cell polarity regulator beta
7	1026970.XP_008840766.1	0.828	Wiskott-Aldrich syndrome
8	1026970.XP_008835118.1	0.827	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments
9	1026970.XP_008834294.1	0.823	Exocyst complex component 4 isoform X1
10	1026970.XP_008830752.1	0.820	Rho guanine nucleotide exchange factor 40
11	1026970.XP_008834160.1	0.819	Intersectin-1 isoform X1
12	1026970.XP_008846948.1	0.819	Intersectin 2
13	1026970.XP_008826649.1	0.811	Rho GDP-dissociation inhibitor 1
14	1026970.XP_008820009.1	0.806	MCF.2 cell line derived transforming sequence
15	1026970.XP_008837296.1	0.793	Par-6 family cell polarity regulator alpha
16	1026970.XP_008824205.1	0.786	Cbl proto-oncogene
17	1026970.XP_008850709.1	0.785	Exocyst complex component 3 isoform X1
18	1026970.XP_008854062.1	0.783	Solute carrier family 2 member 4
19	1026970.XP_008847845.1	0.775	Exocyst complex component 6
20	1026970.XP_008847466.1	0.770	Par-6 family cell polarity regulator gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016817	0.985	hydrolase activity, acting on acid anhydrides
GO:0003924	0.983	GTPase activity
GO:1901363	0.869	heterocyclic compound binding
GO:0097159	0.869	organic cyclic compound binding
GO:0019899	0.836	enzyme binding
GO:0043167	0.804	ion binding
GO:0097367	0.802	carbohydrate derivative binding
GO:0036094	0.776	small molecule binding
GO:0043168	0.655	anion binding
GO:0000166	0.570	nucleotide binding
GO:0032561	0.527	guanyl ribonucleotide binding
GO:0005525	0.502	GTP binding
GO:0019900	0.420	kinase binding
GO:0019901	0.374	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0050896	0.990	response to stimulus
GO:0051716	0.956	cellular response to stimulus
GO:0030029	0.944	actin filament-based process
GO:0016043	0.934	cellular component organization
GO:0006996	0.895	organelle organization
GO:1904375	0.891	regulation of protein localization to cell periphery
GO:0048518	0.815	positive regulation of biological process
GO:1905475	0.811	regulation of protein localization to membrane
GO:0030036	0.785	actin cytoskeleton organization
GO:0010033	0.783	response to organic substance
GO:0048522	0.775	positive regulation of cellular process
GO:1903076	0.758	regulation of protein localization to plasma membrane
GO:0007154	0.757	cell communication
GO:0023052	0.751	signaling
GO:0007165	0.741	signal transduction
GO:0010827	0.706	regulation of glucose transmembrane transport
GO:0046324	0.679	regulation of glucose import
GO:0009719	0.633	response to endogenous stimulus
GO:0070887	0.633	cellular response to chemical stimulus
GO:0050793	0.619	regulation of developmental process
GO:0051050	0.570	positive regulation of transport
GO:0022603	0.562	regulation of anatomical structure morphogenesis
GO:0048519	0.528	negative regulation of biological process
GO:0051128	0.465	regulation of cellular component organization
GO:0048523	0.401	negative regulation of cellular process
GO:0019222	0.400	regulation of metabolic process
GO:0032501	0.357	multicellular organismal process
GO:0051179	0.336	localization
GO:0048583	0.331	regulation of response to stimulus
GO:0044237	0.317	cellular metabolic process
GO:0031323	0.300	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005622	0.930	intracellular anatomical structure
GO:0043226	0.911	organelle
GO:0005737	0.904	cytoplasm
GO:0043229	0.867	intracellular organelle
GO:0043227	0.824	membrane-bounded organelle
GO:0043231	0.758	intracellular membrane-bounded organelle
GO:0012505	0.580	endomembrane system
GO:0070062	0.437	extracellular exosome
GO:0005829	0.414	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.-.-	0.985	Acting on acid anhydrides.
RHEA:19669	0.983	GTP + H2O = GDP + H(+) + phosphate

[back to server]