StarFunc result for job id P17096

User Input

>input (107 residues)
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17095	0.677	0.677	1.001E-11	107	0.972	0.972	P17095.pdb.gz	HMGA1_MOUSE High mobility group protein HMG-I/HMG-Y OS=Mus musculus OX=10090 GN=Hmga1 PE=1 SV=4
2	AFDB:P28361	0.119	0.063	9.519	249	0.206	0.088	P28361.pdb.gz	MSX1_CHICK Homeobox protein MSX-1 OS=Gallus gallus OX=9031 GN=MSX1 PE=2 SV=1
3	AFDB:Q8IZS5	0.219	0.130	9.519	231	0.187	0.087	Q8IZS5.pdb.gz	OFCC1_HUMAN Orofacial cleft 1 candidate gene 1 protein OS=Homo sapiens OX=9606 GN=OFCC1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17096	2.87e-66	196	107	1.000	1.000	HMGA1_HUMAN High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3
2	P17095	3.40e-64	191	107	0.972	0.972	HMGA1_MOUSE High mobility group protein HMG-I/HMG-Y OS=Mus musculus OX=10090 GN=Hmga1 PE=1 SV=4
3	O88791	1.61e-13	63.2	107	0.495	0.495	O88791_RAT High mobility group AT-hook 2 OS=Rattus norvegicus OX=10116 GN=Hmga2 PE=1 SV=1
4	Q6NV11	2.53e-13	62.4	101	0.439	0.465	Q6NV11_DANRE High mobility group AT-hook 1a OS=Danio rerio OX=7955 GN=zgc:85677 PE=1 SV=1
5	P52927	1.39e-12	60.8	108	0.430	0.426	HMGA2_MOUSE High mobility group protein HMGI-C OS=Mus musculus OX=10090 GN=Hmga2 PE=1 SV=1
6	E9QD31	2.11e-12	60.1	100	0.430	0.460	E9QD31_DANRE High mobility group AT-hook 1a OS=Danio rerio OX=7955 GN=hmga1 PE=1 SV=1
7	A0A8I6A172	1.34e-11	58.2	101	0.430	0.455	A0A8I6A172_RAT High mobility group AT-hook 2 OS=Rattus norvegicus OX=10116 GN=Hmga2 PE=3 SV=1
8	P52926	2.45e-10	55.1	109	0.402	0.394	HMGA2_HUMAN High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1
9	A0A8I6GCP7	2.31e-08	50.4	128	0.336	0.281	A0A8I6GCP7_RAT High mobility group AT-hook 2 OS=Rattus norvegicus OX=10116 GN=Hmga2 PE=3 SV=1
10	Q92952	0.024	35.0	543	0.140	0.028	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
11	Q4G176	0.10	33.5	576	0.271	0.050	ACSF3_HUMAN Malonate--CoA ligase ACSF3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=3
12	Q9Y5P8	0.22	32.3	575	0.234	0.043	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
13	P41593	0.34	32.0	591	0.168	0.030	PTH1R_MOUSE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Mus musculus OX=10090 GN=Pth1r PE=1 SV=2
14	O33268	0.55	31.2	882	0.187	0.023	O33268_MYCTU Probable iron-sulfur-binding reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0338c PE=1 SV=1
15	G5EDQ2	1.3	30.0	315	0.243	0.083	HMG12_CAEEL High mobility group protein hmg-12 OS=Caenorhabditis elegans OX=6239 GN=hmg-12 PE=1 SV=1
16	Q9SR17	2.8	29.3	315	0.168	0.057	AHL19_ARATH AT-hook motif nuclear-localized protein 19 OS=Arabidopsis thaliana OX=3702 GN=AHL19 PE=2 SV=1
17	Q9C9K7	3.9	28.9	302	0.159	0.056	AHL29_ARATH AT-hook motif nuclear-localized protein 29 OS=Arabidopsis thaliana OX=3702 GN=AHL29 PE=1 SV=1
18	Q9SJG4	5.2	28.1	257	0.112	0.047	AHL16_ARATH AT-hook motif nuclear-localized protein 16 OS=Arabidopsis thaliana OX=3702 GN=AHL16 PE=1 SV=1
19	Q6DBQ1	8.9	27.7	299	0.103	0.037	AHL25_ARATH AT-hook motif nuclear-localized protein 25 OS=Arabidopsis thaliana OX=3702 GN=AHL25 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02178 AT_hook	22	16.2	AT hook motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008592144.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572060.1	0.865	Cellular tumor antigen p53
2	482537.XP_008580726.1	0.693	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 17 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008565305.1	0.692	Insulin-induced gene 1 protein
4	482537.XP_008581881.1	0.655	Transcription elongation factor A protein-like 1
5	482537.XP_008574909.1	0.650	Retinoblastoma-associated protein
6	482537.XP_008579396.1	0.650	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008570075.1	0.647	CCAAT/enhancer-binding protein beta
8	482537.XP_008577269.1	0.643	lamin-B1
9	482537.XP_008586438.1	0.612	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 18 Proteins, and 89% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
10	482537.XP_008581706.1	0.587	Mevalonate kinase
11	482537.XP_008583575.1	0.585	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
12	482537.XP_008566046.1	0.581	High mobility group protein HMGI-C isoform X1
13	482537.XP_008574544.1	0.580	Squalene synthase isoform X1
14	482537.XP_008571093.1	0.577	Peroxisome proliferator-activated receptor gamma
15	482537.XP_008566837.1	0.557	Matrin-3 isoform X1
16	482537.XP_008564101.1	0.555	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
17	482537.XP_008590830.1	0.552	Phosphomevalonate kinase isoform X1
18	482537.XP_008593309.1	0.552	Phosphomevalonate kinase isoform X1
19	482537.XP_008582451.1	0.550	High mobility group protein B2 isoform X1
20	482537.XP_008570051.1	0.543	Zinc finger Ran-binding domain-containing protein 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030527	0.998	structural constituent of chromatin
GO:0003713	0.998	transcription coactivator activity
GO:0003680	0.998	minor groove of adenine-thymine-rich DNA binding
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.993	chromatin binding
GO:0005515	0.992	protein binding
GO:0003824	0.542	catalytic activity
GO:0019899	0.373	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0045935	0.987	positive regulation of nucleobase-containing compound metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0051252	0.968	regulation of RNA metabolic process
GO:0009987	0.964	cellular process
GO:0010468	0.961	regulation of gene expression
GO:0009891	0.947	positive regulation of biosynthetic process
GO:0010556	0.933	regulation of macromolecule biosynthetic process
GO:0031326	0.933	regulation of cellular biosynthetic process
GO:0010604	0.929	positive regulation of macromolecule metabolic process
GO:0010557	0.919	positive regulation of macromolecule biosynthetic process
GO:0031328	0.918	positive regulation of cellular biosynthetic process
GO:0006355	0.917	regulation of DNA-templated transcription
GO:0045893	0.905	positive regulation of DNA-templated transcription
GO:0006357	0.871	regulation of transcription by RNA polymerase II
GO:0071704	0.823	organic substance metabolic process
GO:0048519	0.773	negative regulation of biological process
GO:0044238	0.759	primary metabolic process
GO:0048523	0.625	negative regulation of cellular process
GO:0050896	0.623	response to stimulus
GO:0051172	0.608	negative regulation of nitrogen compound metabolic process
GO:0010605	0.604	negative regulation of macromolecule metabolic process
GO:0031324	0.588	negative regulation of cellular metabolic process
GO:0051716	0.567	cellular response to stimulus
GO:0044237	0.532	cellular metabolic process
GO:0045934	0.522	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.501	negative regulation of RNA metabolic process
GO:0010558	0.487	negative regulation of macromolecule biosynthetic process
GO:0031327	0.485	negative regulation of cellular biosynthetic process
GO:0071840	0.472	cellular component organization or biogenesis
GO:0006807	0.459	nitrogen compound metabolic process
GO:0045892	0.426	negative regulation of DNA-templated transcription
GO:0043170	0.408	macromolecule metabolic process
GO:0016043	0.406	cellular component organization
GO:1901360	0.400	organic cyclic compound metabolic process
GO:0045944	0.390	positive regulation of transcription by RNA polymerase II
GO:0006950	0.363	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005667	0.993	transcription regulator complex
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0000785	0.972	chromatin
GO:0140513	0.576	nuclear protein-containing complex
GO:0090575	0.540	RNA polymerase II transcription regulator complex
GO:0012505	0.406	endomembrane system
GO:0030054	0.403	cell junction
GO:0070161	0.376	anchoring junction
GO:0030055	0.318	cell-substrate junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]