StarFunc result for job id P17174

User Input

>input (413 residues)
MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQK
IANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFL
ARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLEN
APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWA
IRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPP
AQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGM
FSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK69	0.998	0.998	5.079E-75	413	1.000	1.000	A0A140VK69.pdb.gz	A0A140VK69_HUMAN Aspartate aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P00504	0.994	0.997	3.410E-67	412	0.801	0.803	P00504.pdb.gz	AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus OX=9031 GN=GOT1 PE=1 SV=3
3	PDB:3wzfA	0.983	0.985	3.886E-66	412	0.998	1.000	3wzfA.pdb.gz
4	PDB:2cstA	0.983	0.987	2.701E-61	411	0.797	0.800	2cstA.pdb.gz	Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 A resolution.
5	AFDB:Q8IHB4	0.960	0.886	4.137E-53	448	0.554	0.511	Q8IHB4.pdb.gz	Q8IHB4_DROME AT16867p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Got1 PE=2 SV=1
6	AFDB:P46644	0.967	0.890	1.205E-52	449	0.492	0.452	P46644.pdb.gz	AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
7	AFDB:Q22067	0.971	0.983	1.635E-52	408	0.533	0.539	Q22067.pdb.gz	AATC_CAEEL Aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=got-1.2 PE=1 SV=1
8	AFDB:Q5B082	0.968	0.899	3.841E-51	445	0.523	0.485	Q5B082.pdb.gz	Q5B082_EMENI Aspartate transaminase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06048 PE=3 SV=1
9	AFDB:P46645	0.967	0.986	3.796E-50	405	0.484	0.494	P46645.pdb.gz	AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
10	AFDB:Q8IPY3	0.956	0.917	5.153E-50	431	0.458	0.439	Q8IPY3.pdb.gz	Q8IPY3_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=1 SV=1
11	AFDB:F4I0D4	0.965	0.984	6.316E-50	405	0.482	0.491	F4I0D4.pdb.gz	F4I0D4_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP4 PE=1 SV=1
12	AFDB:P00505	0.954	0.916	1.426E-49	430	0.475	0.456	P00505.pdb.gz	AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3
13	PDB:3pd6A	0.950	0.978	4.065E-48	401	0.472	0.486	3pd6A.pdb.gz	Biochemical and structural characterization of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-IV.
14	PDB:7aatA	0.946	0.974	1.970E-47	401	0.455	0.469	7aatA.pdb.gz	X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase.
15	PDB:6jpkA	0.953	0.963	3.629E-47	409	0.465	0.469	6jpkA.pdb.gz	Crystal structure of L-aspartate aminotransferase from Schizosaccharomyces pombe.
16	PDB:1yaaA	0.945	0.947	2.425E-43	412	0.458	0.459	1yaaA.pdb.gz	Crystal structure of Saccharomyces cerevisiae cytosolic aspartate aminotransferase.
17	PDB:4eu1A	0.897	0.966	2.654E-42	383	0.395	0.426	4eu1A.pdb.gz
18	PDB:3fslA	0.936	0.973	8.560E-42	397	0.392	0.408	3fslA.pdb.gz	Crystal structure of tyrosine aminotransferase tripple mutant (P181Q,R183G,A321K) from Escherichia coli at 2.35 A resolution
19	PDB:4f5fB	0.934	0.964	1.286E-41	400	0.397	0.410	4f5fB.pdb.gz
20	PDB:5yhvA	0.709	0.739	3.101E-16	394	0.179	0.188	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK69	0.0	860	413	1.000	1.000	A0A140VK69_HUMAN Aspartate aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	P00504	0.0	706	412	0.797	0.799	AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus OX=9031 GN=GOT1 PE=1 SV=3
3	P05201	0.0	790	413	0.908	0.908	AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus OX=10090 GN=Got1 PE=1 SV=3
4	P13221	0.0	786	413	0.903	0.903	AATC_RAT Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Got1 PE=1 SV=3
5	P17174	0.0	860	413	1.000	1.000	AATC_HUMAN Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3
6	Q7YWB4	6.94e-171	486	416	0.557	0.553	Q7YWB4_DROME Aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got1 PE=2 SV=1
7	Q8IHB4	1.59e-170	486	448	0.557	0.513	Q8IHB4_DROME AT16867p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Got1 PE=2 SV=1
8	Q7K221	5.47e-170	484	416	0.554	0.550	Q7K221_DROME Glutamate oxaloacetate transaminase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Got1 PE=1 SV=1
9	A1ZAA5	9.87e-170	484	437	0.554	0.524	A1ZAA5_DROME Glutamate oxaloacetate transaminase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Got1 PE=1 SV=1
10	Q22067	6.44e-159	455	408	0.533	0.539	AATC_CAEEL Aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=got-1.2 PE=1 SV=1
11	Q5B082	1.42e-151	438	445	0.518	0.481	Q5B082_EMENI Aspartate transaminase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06048 PE=3 SV=1
12	P46644	1.56e-147	428	449	0.492	0.452	AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
13	P46645	4.44e-146	422	405	0.484	0.494	AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
14	F4I0D4	3.06e-140	408	405	0.482	0.491	F4I0D4_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP4 PE=1 SV=1
15	P00505	8.12e-139	405	430	0.479	0.460	AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3
16	P05202	1.34e-138	404	430	0.477	0.458	AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1
17	P00507	4.95e-138	403	430	0.472	0.453	AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Got2 PE=1 SV=2
18	P12345	8.62e-138	402	430	0.472	0.453	AATM_RABIT Aspartate aminotransferase, mitochondrial OS=Oryctolagus cuniculus OX=9986 GN=GOT2 PE=1 SV=2
19	Q9VQ61	8.18e-137	400	424	0.465	0.453	Q9VQ61_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=1 SV=1
20	Q8IPY3	1.31e-136	399	431	0.465	0.445	Q8IPY3_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	2.5e-89	311.6	Aminotransferase class I and II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359539

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438144	0.989	Malate dehydrogenase, cytoplasmic
2	9606.ENSP00000345282	0.982	Alanine aminotransferase 2
3	9606.ENSP00000277865	0.973	Glutamate dehydrogenase 1, mitochondrial
4	9606.ENSP00000327589	0.972	Glutamate dehydrogenase 2, mitochondrial
5	9606.ENSP00000378408	0.972	Alanine aminotransferase 1
6	9606.ENSP00000327070	0.969	Malate dehydrogenase, mitochondrial
7	9606.ENSP00000359976	0.957	Cystathionine gamma-lyase
8	9606.ENSP00000364490	0.955	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
9	9606.ENSP00000264705	0.953	CAD protein
10	9606.ENSP00000280706	0.952	L-lactate dehydrogenase A-like 6A
11	9606.ENSP00000302393	0.950	Lactate dehydrogenase A like 6B
12	9606.ENSP00000379386	0.949	Lactate dehydrogenase B
13	9606.ENSP00000175506	0.946	Asparagine synthetase
14	9606.ENSP00000355518	0.943	Fumarate hydratase, mitochondrial
15	9606.ENSP00000348234	0.941	Tyrosine aminotransferase
16	9606.ENSP00000361471	0.941	Argininosuccinate synthase
17	9606.ENSP00000445175	0.941	Lactate dehydrogenase A
18	9606.ENSP00000260508	0.940	Kynurenine--oxoglutarate transaminase 3
19	9606.ENSP00000380402	0.939	3-mercaptopyruvate sulfurtransferase
20	9606.ENSP00000399415	0.936	Kynurenine--oxoglutarate transaminase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004069	1.000	L-aspartate:2-oxoglutarate aminotransferase activity
GO:0005515	0.977	protein binding
GO:0042802	0.457	identical protein binding
GO:0097159	0.352	organic cyclic compound binding
GO:1901363	0.329	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044238	0.996	primary metabolic process
GO:0043648	0.996	dicarboxylic acid metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0044282	0.978	small molecule catabolic process
GO:0046395	0.971	carboxylic acid catabolic process
GO:1901605	0.966	alpha-amino acid metabolic process
GO:0043649	0.917	dicarboxylic acid catabolic process
GO:0009063	0.903	amino acid catabolic process
GO:1901606	0.858	alpha-amino acid catabolic process
GO:0009066	0.732	aspartate family amino acid metabolic process
GO:0009058	0.645	biosynthetic process
GO:0050896	0.390	response to stimulus
GO:1901576	0.353	organic substance biosynthetic process
GO:0009064	0.340	glutamine family amino acid metabolic process
GO:0043603	0.305	amide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.983	membrane-bounded organelle
GO:0031974	0.972	membrane-enclosed lumen
GO:0070013	0.958	intracellular organelle lumen
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0005634	0.888	nucleus
GO:0005576	0.874	extracellular region
GO:0005654	0.348	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21824	1.000	2-oxoglutarate + L-aspartate = L-glutamate + oxaloacetate
EC:2.6.1.1	1.000	aspartate transaminase.

[back to server]