StarFunc result for job id P17181

User Input

>input (557 residues)
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI
ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ
NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN
EDESESKTSEELQQDFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17181	1.000	1.000	8.196E-98	557	1.000	1.000	P17181.pdb.gz	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
2	AFDB:D3ZDS9	0.694	0.655	4.180E-59	593	0.499	0.469	D3ZDS9.pdb.gz	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
3	AFDB:P33896	0.671	0.637	1.164E-58	590	0.492	0.464	P33896.pdb.gz	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2
4	AFDB:Q2EY14	0.214	0.118	2.889E-23	1149	0.167	0.081	Q2EY14.pdb.gz	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
5	AFDB:A8WH79	0.260	0.176	1.826E-21	866	0.129	0.083	A8WH79.pdb.gz	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
6	AFDB:A0A2R8PZ02	0.300	0.262	4.830E-21	655	0.156	0.133	A0A2R8PZ02.pdb.gz
7	AFDB:Q8K5B1	0.275	0.220	5.351E-21	716	0.140	0.109	Q8K5B1.pdb.gz	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
8	AFDB:Q8NI17	0.242	0.189	5.351E-21	732	0.145	0.111	Q8NI17.pdb.gz	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
9	AFDB:D4A3R0	0.263	0.182	5.928E-21	838	0.163	0.109	D4A3R0.pdb.gz	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
10	AFDB:Q53U87	0.186	0.094	3.050E-20	1331	0.131	0.055	Q53U87.pdb.gz	Q53U87_CAEEL Neuroglian OS=Caenorhabditis elegans OX=6239 GN=sax-7 PE=1 SV=1
11	PDB:8eyyA	0.194	0.151	9.929E-12	775	0.084	0.061	8eyyA.pdb.gz
12	PDB:6pxvA	0.185	0.137	2.626E-11	823	0.088	0.060	6pxvA.pdb.gz
13	PDB:8dtlA	0.190	0.155	5.660E-11	741	0.093	0.070	8dtlA.pdb.gz
14	PDB:6pyhD	0.186	0.142	1.660E-9	798	0.088	0.061	6pyhD.pdb.gz
15	PDB:7z0lB	0.266	0.379	3.578E-9	370	0.063	0.095	7z0lB.pdb.gz
16	PDB:3besR	0.268	0.535	7.327E-9	250	0.059	0.132	3besR.pdb.gz
17	PDB:4lnvB	0.132	0.084	3.234E-8	1063	0.075	0.040	4lnvB.pdb.gz
18	PDB:7u7nC	0.278	0.675	3.403E-8	200	0.061	0.170	7u7nC.pdb.gz
19	PDB:5oj2B	0.165	0.138	7.335E-8	692	0.097	0.078	5oj2B.pdb.gz
20	PDB:7q5zA	0.132	0.068	7.335E-8	1344	0.088	0.036	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZDS9	0.0	527	593	0.483	0.454	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
2	P17181	0.0	1151	557	1.000	1.000	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
3	A0A8I6AH72	2.33e-178	517	582	0.478	0.457	A0A8I6AH72_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
4	P33896	4.62e-172	501	590	0.478	0.451	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2
5	A0A0G2JXD8	2.98e-123	371	439	0.348	0.442	A0A0G2JXD8_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
6	Q08334	7.11e-20	93.2	325	0.142	0.243	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
7	K7NA32	2.82e-17	86.3	405	0.165	0.227	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
8	Q61190	7.67e-17	84.3	349	0.142	0.226	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
9	K7NAJ3	6.04e-15	79.0	388	0.147	0.211	IRA1B_ONCMY Interferon alpha/beta receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=ifnar1b PE=2 SV=1
10	Q63953	4.55e-13	72.8	332	0.117	0.196	Q63953_MOUSE Ifngr2 protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=1 SV=1
11	Q3UVK9	5.12e-13	72.8	332	0.117	0.196	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
12	Q8C352	8.03e-13	70.1	213	0.101	0.263	Q8C352_MOUSE Fibronectin type-III domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
13	D4A109	5.95e-12	69.3	330	0.108	0.182	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
14	K9JA28	3.19e-09	62.0	567	0.083	0.081	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
15	Q6PHB0	1.13e-08	60.1	546	0.099	0.101	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
16	Q9UHF4	1.78e-08	59.7	553	0.065	0.065	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
17	Q8N6P7	4.56e-07	55.1	574	0.074	0.071	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
18	P38484	4.30e-06	51.2	337	0.093	0.154	INGR2_HUMAN Interferon gamma receptor 2 OS=Homo sapiens OX=9606 GN=IFNGR2 PE=1 SV=2
19	Q6UXL0	9.74e-06	50.1	311	0.127	0.228	I20RB_HUMAN Interleukin-20 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL20RB PE=1 SV=1
20	Q969J5	3.47e-05	48.1	263	0.072	0.152	I22R2_HUMAN Interleukin-22 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL22RA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11020 DUF2610	4.8e+02	12.0	Domain of unknown function (DUF2610)
2	PF00041 fn3	0.069	24.8	Fibronectin type III domain
3	PF09294 Interfer-bind	3e-39	144.8	Interferon-alpha/beta receptor, fibronectin type III
4	PF01108 Tissue_fac	1.5e-26	103.7	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315768	0.999	Signal transducer and activator of transcription 2
2	9606.ENSP00000343204	0.999	Tyrosine-protein kinase JAK1
3	9606.ENSP00000343957	0.999	Interferon alpha/beta receptor 2
4	9606.ENSP00000369554	0.999	Interferon alpha-2
5	9606.ENSP00000369581	0.999	Interferon beta
6	9606.ENSP00000431885	0.999	Non-receptor tyrosine-protein kinase TYK2
7	9606.ENSP00000354394	0.998	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000276927	0.996	Interferon alpha-1/13
9	9606.ENSP00000369578	0.992	Interferon omega 1
10	9606.ENSP00000380073	0.989	Interferon regulatory factor 9
11	9606.ENSP00000356713	0.978	Interferon gamma receptor 1
12	9606.ENSP00000426909	0.964	Receptor of activated protein C kinase 1
13	9606.ENSP00000369574	0.957	Interferon alpha-21
14	9606.ENSP00000369553	0.956	Interferon alpha-8
15	9606.ENSP00000411940	0.954	Interferon alpha-17
16	9606.ENSP00000229135	0.952	Interferon gamma
17	9606.ENSP00000412897	0.947	Interferon alpha-4
18	9606.ENSP00000301178	0.944	Tyrosine-protein kinase receptor UFO
19	9606.ENSP00000360683	0.942	Tyrosine-protein phosphatase non-receptor type 1
20	9606.ENSP00000340944	0.938	Tyrosine-protein phosphatase non-receptor type 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0004904	1.000	interferon receptor activity
GO:0004905	0.947	type I interferon receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0019221	0.994	cytokine-mediated signaling pathway
GO:0031323	0.988	regulation of cellular metabolic process
GO:0051707	0.987	response to other organism
GO:0048518	0.985	positive regulation of biological process
GO:0006955	0.983	immune response
GO:0098542	0.982	defense response to other organism
GO:0048522	0.975	positive regulation of cellular process
GO:0045087	0.958	innate immune response
GO:0009893	0.948	positive regulation of metabolic process
GO:0034340	0.929	response to type I interferon
GO:0140888	0.929	interferon-mediated signaling pathway
GO:0031325	0.873	positive regulation of cellular metabolic process
GO:0097696	0.861	receptor signaling pathway via STAT
GO:0009615	0.843	response to virus
GO:0071357	0.814	cellular response to type I interferon
GO:0060255	0.697	regulation of macromolecule metabolic process
GO:0043467	0.653	regulation of generation of precursor metabolites and energy
GO:0043457	0.592	regulation of cellular respiration
GO:0007259	0.442	receptor signaling pathway via JAK-STAT
GO:0051171	0.405	regulation of nitrogen compound metabolic process
GO:0080090	0.402	regulation of primary metabolic process
GO:0010604	0.399	positive regulation of macromolecule metabolic process
GO:0010468	0.386	regulation of gene expression
GO:0051239	0.363	regulation of multicellular organismal process
GO:0048583	0.329	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.698	intracellular anatomical structure
GO:0043226	0.395	organelle
GO:0043231	0.372	intracellular membrane-bounded organelle
GO:0005737	0.315	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]