StarFunc result for job id P17213

User Input

>input (487 residues)
MRENMARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKEL
KRIKIPDYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISG
KWKAQKRFLKMSGNFDLSIEGMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKS
KVGWLIQLFHKKIESALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGINYGL
VAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLV
YQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQ
PTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLF
GADVVYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17213	1.000	1.000	4.220E-97	487	1.000	1.000	P17213.pdb.gz	BPI_HUMAN Bactericidal permeability-increasing protein OS=Homo sapiens OX=9606 GN=BPI PE=1 SV=4
2	PDB:1bp1A	0.930	0.993	1.006E-85	456	0.932	0.996	1bp1A.pdb.gz
3	AFDB:Q6AXU0	0.943	0.952	6.862E-70	482	0.548	0.554	Q6AXU0.pdb.gz	BPI_RAT Bactericidal permeability-increasing protein OS=Rattus norvegicus OX=10116 GN=Bpi PE=2 SV=1
4	AFDB:Q67E05	0.933	0.940	6.426E-68	483	0.520	0.524	Q67E05.pdb.gz	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
5	AFDB:P18428	0.897	0.908	3.895E-64	481	0.429	0.435	P18428.pdb.gz	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
6	AFDB:Q63313	0.923	0.934	4.907E-63	481	0.405	0.410	Q63313.pdb.gz	LBP_RAT Lipopolysaccharide-binding protein OS=Rattus norvegicus OX=10116 GN=Lbp PE=2 SV=1
7	AFDB:Q61805	0.907	0.918	5.107E-61	481	0.409	0.414	Q61805.pdb.gz	LBP_MOUSE Lipopolysaccharide-binding protein OS=Mus musculus OX=10090 GN=Lbp PE=1 SV=2
8	AFDB:P17454	0.892	0.901	4.303E-59	482	0.396	0.400	P17454.pdb.gz	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
9	PDB:4m4dA	0.680	0.734	1.808E-53	448	0.394	0.429	4m4dA.pdb.gz
10	AFDB:Q9MAU5	0.861	0.859	1.854E-43	488	0.218	0.217	Q9MAU5.pdb.gz	Y1049_ARATH Putative BPI/LBP family protein At1g04970 OS=Arabidopsis thaliana OX=3702 GN=At1g04970 PE=2 SV=1
11	AFDB:P55065	0.824	0.815	2.513E-41	493	0.240	0.237	P55065.pdb.gz	PLTP_MOUSE Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1
12	AFDB:Q8WMN7	0.825	0.811	3.636E-41	496	0.244	0.240	Q8WMN7.pdb.gz	Q8WMN7_PIG Plasma phospholipid transfer protein OS=Sus scrofa OX=9823 GN=PLTP PE=2 SV=1
13	PDB:4ewsA	0.640	0.657	5.757E-32	472	0.193	0.199	4ewsA.pdb.gz	Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.
14	PDB:3h4zA	0.260	0.227	3.866E-7	568	0.051	0.044	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
15	PDB:6baqF	0.180	0.347	1.097E-4	211	0.037	0.085	6baqF.pdb.gz
16	PDB:3zpmA	0.188	0.364	9.550E-4	211	0.051	0.118	3zpmA.pdb.gz
17	PDB:4kegA	0.178	0.165	1.311E-3	535	0.041	0.037	4kegA.pdb.gz	The Lipid Ligands of the SPLUNC1 Protein
18	PDB:7svmA	0.082	0.056	2.151E-2	852	0.084	0.048	7svmA.pdb.gz	A Phenotypic Screen Identifies Potent DPP9 Inhibitors Capable of Killing HIV-1 Infected Cells.
19	PDB:3b07B	0.055	0.081	4.271E-2	270	0.078	0.141	3b07B.pdb.gz
20	PDB:7ayqA	0.082	0.057	4.503E-2	808	0.070	0.042	7ayqA.pdb.gz	Chemoproteomics-Enabled Identification of 4-Oxo-beta-Lactams as Inhibitors of Dipeptidyl Peptidases 8 and 9.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17213	0.0	1006	487	1.000	1.000	BPI_HUMAN Bactericidal permeability-increasing protein OS=Homo sapiens OX=9606 GN=BPI PE=1 SV=4
2	Q67E05	0.0	545	483	0.532	0.536	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
3	Q6AXU0	0.0	567	482	0.548	0.554	BPI_RAT Bactericidal permeability-increasing protein OS=Rattus norvegicus OX=10116 GN=Bpi PE=2 SV=1
4	P18428	2.15e-140	414	481	0.425	0.430	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
5	Q61805	2.37e-140	414	481	0.409	0.414	LBP_MOUSE Lipopolysaccharide-binding protein OS=Mus musculus OX=10090 GN=Lbp PE=1 SV=2
6	Q63313	3.35e-133	395	481	0.398	0.403	LBP_RAT Lipopolysaccharide-binding protein OS=Rattus norvegicus OX=10116 GN=Lbp PE=2 SV=1
7	P17454	9.84e-131	389	482	0.386	0.390	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
8	P55058	4.44e-49	177	493	0.255	0.252	PLTP_HUMAN Phospholipid transfer protein OS=Homo sapiens OX=9606 GN=PLTP PE=1 SV=1
9	P55065	9.47e-49	176	493	0.251	0.247	PLTP_MOUSE Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1
10	Q8WMN7	4.82e-47	172	496	0.257	0.252	Q8WMN7_PIG Plasma phospholipid transfer protein OS=Sus scrofa OX=9823 GN=PLTP PE=2 SV=1
11	F4JDK0	3.04e-36	144	722	0.244	0.165	F4JDK0_ARATH Lipid-binding serum glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=LBR-2 PE=1 SV=1
12	Q9MAU5	5.45e-30	124	488	0.224	0.223	Y1049_ARATH Putative BPI/LBP family protein At1g04970 OS=Arabidopsis thaliana OX=3702 GN=At1g04970 PE=2 SV=1
13	P11597	8.55e-24	106	493	0.230	0.227	CETP_HUMAN Cholesteryl ester transfer protein OS=Homo sapiens OX=9606 GN=CETP PE=1 SV=2
14	P47896	1.23e-21	99.8	493	0.218	0.215	CETP_MACFA Cholesteryl ester transfer protein OS=Macaca fascicularis OX=9541 GN=CETP PE=1 SV=1
15	P22687	3.76e-21	98.6	497	0.175	0.171	CETP_RABIT Cholesteryl ester transfer protein (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=CETP PE=1 SV=1
16	G3HIK4	2.17e-19	93.2	492	0.181	0.179	CETP_CRIGR Cholesteryl ester transfer protein OS=Cricetulus griseus OX=10029 GN=CETP PE=3 SV=2
17	Q8N4F0	9.29e-19	90.9	458	0.211	0.225	BPIB2_HUMAN BPI fold-containing family B member 2 OS=Homo sapiens OX=9606 GN=BPIFB2 PE=1 SV=2
18	P59827	4.78e-16	83.2	614	0.179	0.142	BPIB4_HUMAN BPI fold-containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=2 SV=2
19	A0A669KBJ0	4.83e-16	83.2	736	0.179	0.118	A0A669KBJ0_HUMAN BPI fold containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=1 SV=1
20	P59826	9.67e-08	56.6	472	0.146	0.150	BPIB3_HUMAN BPI fold-containing family B member 3 OS=Homo sapiens OX=9606 GN=BPIFB3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01273 LBP_BPI_CETP	3e-50	181.5	LBP / BPI / CETP family, N-terminal domain
2	PF02886 LBP_BPI_CETP_C	2e-97	336.9	LBP / BPI / CETP family, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262865

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217407	0.906	Lipopolysaccharide-binding protein
2	9606.ENSP00000297435	0.859	Neutrophil defensin 4
3	9606.ENSP00000225275	0.847	Myeloperoxidase
4	9606.ENSP00000466090	0.843	Neutrophil elastase
5	9606.ENSP00000346251	0.815	BPI fold-containing family A member 1
6	9606.ENSP00000233997	0.811	Azurocidin
7	9606.ENSP00000244336	0.807	Carcinoembryonic antigen related cell adhesion molecule family
8	9606.ENSP00000330484	0.768	Belongs to the glycosyl hydrolase 13 family
9	9606.ENSP00000359096	0.768	Amylase, alpha 1C
10	9606.ENSP00000359100	0.768	Amylase, alpha 1A
11	9606.ENSP00000216336	0.766	Cathepsin G
12	9606.ENSP00000296435	0.756	Cathelicidin antimicrobial peptide
13	9606.ENSP00000234347	0.742	Myeloblastin
14	9606.ENSP00000253362	0.719	BPI fold-containing family A member 2
15	9606.ENSP00000459533	0.648	Lipopolysaccharide-induced tumor necrosis factor-alpha factor
16	9606.ENSP00000008938	0.644	Peptidoglycan recognition protein 1
17	9606.ENSP00000481450	0.630	Pancreatic alpha-amylase
18	9606.ENSP00000253354	0.583	BPI fold-containing family B member 1
19	9606.ENSP00000328359	0.570	Neutrophil defensin 3
20	9606.ENSP00000372139	0.516	Neutrophil defensin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001530	1.000	lipopolysaccharide binding
GO:0005515	0.952	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0002376	0.994	immune system process
GO:0006952	0.994	defense response
GO:0051707	0.994	response to other organism
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0001817	0.987	regulation of cytokine production
GO:0098542	0.984	defense response to other organism
GO:0006955	0.982	immune response
GO:0009617	0.977	response to bacterium
GO:0032677	0.967	regulation of interleukin-8 production
GO:0051716	0.957	cellular response to stimulus
GO:0042221	0.951	response to chemical
GO:0032680	0.947	regulation of tumor necrosis factor production
GO:0019730	0.947	antimicrobial humoral response
GO:0042742	0.936	defense response to bacterium
GO:0002237	0.930	response to molecule of bacterial origin
GO:0002682	0.926	regulation of immune system process
GO:0050865	0.926	regulation of cell activation
GO:0002694	0.924	regulation of leukocyte activation
GO:0070887	0.917	cellular response to chemical stimulus
GO:0071222	0.906	cellular response to lipopolysaccharide
GO:0032675	0.901	regulation of interleukin-6 production
GO:0048519	0.897	negative regulation of biological process
GO:0051241	0.874	negative regulation of multicellular organismal process
GO:0048523	0.811	negative regulation of cellular process
GO:0001818	0.810	negative regulation of cytokine production
GO:0050829	0.769	defense response to Gram-negative bacterium
GO:0043030	0.742	regulation of macrophage activation
GO:0032720	0.728	negative regulation of tumor necrosis factor production
GO:0002683	0.707	negative regulation of immune system process
GO:0019731	0.660	antibacterial humoral response
GO:0061844	0.640	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0048518	0.615	positive regulation of biological process
GO:0032501	0.471	multicellular organismal process
GO:0048522	0.423	positive regulation of cellular process
GO:0045087	0.402	innate immune response
GO:0010604	0.382	positive regulation of macromolecule metabolic process
GO:0050830	0.371	defense response to Gram-positive bacterium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.996	extracellular exosome
GO:0005737	0.995	cytoplasm
GO:0012505	0.994	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0031410	0.989	cytoplasmic vesicle
GO:0030141	0.967	secretory granule
GO:0034774	0.954	secretory granule lumen
GO:0005766	0.936	primary lysosome
GO:0042582	0.910	azurophil granule
GO:0043232	0.885	intracellular non-membrane-bounded organelle
GO:0005775	0.850	vacuolar lumen
GO:0035578	0.814	azurophil granule lumen
GO:0042581	0.811	specific granule
GO:0016020	0.773	membrane
GO:0035580	0.506	specific granule lumen
GO:0099080	0.457	supramolecular complex
GO:0031090	0.447	organelle membrane
GO:0043202	0.386	lysosomal lumen
GO:1904724	0.385	tertiary granule lumen
GO:0035577	0.384	azurophil granule membrane
GO:0035770	0.368	ribonucleoprotein granule
GO:0031091	0.357	platelet alpha granule
GO:0031093	0.345	platelet alpha granule lumen
GO:0009986	0.337	cell surface
GO:0036464	0.336	cytoplasmic ribonucleoprotein granule
GO:0010494	0.316	cytoplasmic stress granule
GO:0031981	0.314	nuclear lumen
GO:0005654	0.300	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]