StarFunc result for job id P17301

User Input

>input (1181 residues)
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQH
QFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K470	0.711	0.712	0.000	1178	0.816	0.818	A0A0G2K470.pdb.gz	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	AFDB:O75578	0.609	0.616	0.000	1167	0.341	0.345	O75578.pdb.gz	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	AFDB:P17301	1.000	1.000	0.000	1181	1.000	1.000	P17301.pdb.gz	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	AFDB:P18614	0.690	0.691	0.000	1180	0.398	0.398	P18614.pdb.gz	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	AFDB:P56199	0.798	0.800	0.000	1179	0.397	0.398	P56199.pdb.gz	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	AFDB:P61622	0.664	0.661	0.000	1188	0.348	0.346	P61622.pdb.gz	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	AFDB:Q9QXH4	0.571	0.576	1.955E-96	1169	0.268	0.270	Q9QXH4.pdb.gz	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
8	AFDB:Q13349	0.624	0.634	6.961E-96	1161	0.258	0.263	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
9	AFDB:P11215	0.594	0.607	1.569E-95	1152	0.261	0.267	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
10	AFDB:P05555	0.474	0.485	7.836E-94	1153	0.263	0.270	P05555.pdb.gz	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
11	PDB:4nehA	0.447	0.484	1.050E-84	1084	0.240	0.261	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.437	0.481	5.244E-83	1063	0.235	0.261	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:7uslA	0.410	0.554	9.973E-67	856	0.191	0.263	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:4g1eA	0.409	0.493	1.161E-63	964	0.184	0.225	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:3fcsA	0.402	0.508	3.550E-60	913	0.168	0.217	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:3k6sC	0.405	0.528	4.065E-59	885	0.200	0.267	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
17	PDB:7nxdA	0.412	0.524	2.487E-57	905	0.186	0.243	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:4rtdA	0.076	0.079	4.568E-9	1122	0.058	0.061	4rtdA.pdb.gz
19	PDB:5a42A	0.088	0.071	7.591E-9	1597	0.079	0.058	5a42A.pdb.gz
20	PDB:7eebE	0.089	0.096	1.179E-7	1053	0.078	0.087	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K470	0.0	2018	1178	0.806	0.808	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	O75578	0.0	643	1167	0.344	0.348	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	P17301	0.0	2444	1181	0.999	0.999	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	P18614	0.0	813	1180	0.402	0.403	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	P56199	0.0	844	1179	0.410	0.411	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	P61622	0.0	709	1188	0.358	0.356	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	Q3V3R4	0.0	821	1179	0.402	0.403	ITA1_MOUSE Integrin alpha-1 OS=Mus musculus OX=10090 GN=Itga1 PE=1 SV=2
8	Q62469	0.0	2039	1178	0.824	0.826	ITA2_MOUSE Integrin alpha-2 OS=Mus musculus OX=10090 GN=Itga2 PE=1 SV=2
9	Q9UKX5	0.0	710	1188	0.365	0.363	ITA11_HUMAN Integrin alpha-11 OS=Homo sapiens OX=9606 GN=ITGA11 PE=1 SV=2
10	Q9QXH4	3.80e-110	374	1169	0.287	0.290	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
11	P11215	4.99e-107	365	1152	0.289	0.296	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
12	Q9QYE7	7.03e-106	362	1161	0.288	0.293	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
13	P05555	1.09e-105	362	1153	0.285	0.292	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
14	G3V8L7	2.18e-105	361	1151	0.287	0.295	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
15	A0A0G2K4L8	4.50e-105	360	1151	0.285	0.292	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
16	Q3T1L6	9.58e-105	359	1160	0.267	0.272	Q3T1L6_RAT Integrin alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=2 SV=1
17	Q60677	1.08e-104	359	1167	0.251	0.254	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2
18	P20702	1.38e-104	358	1163	0.292	0.297	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
19	A0A8I5Y8A4	5.27e-104	357	1141	0.283	0.293	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
20	F1LP44	8.42e-104	357	1161	0.262	0.267	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	5.2e-20	82.2	FG-GAP repeat
2	PF14312 FG-GAP_2	0.0013	30.2	FG-GAP repeat
3	PF13517 FG-GAP_3	0.028	26.3	FG-GAP-like repeat
4	PF18698 HisK_sensor	32	16.3	Histidine kinase sensor domain
5	PF00357 Integrin_alpha	6.8	18.0	Integrin alpha cytoplasmic region
6	PF08441 Integrin_alpha2	3.6e-43	160.0	Integrin alpha
7	PF00092 VWA	3e-36	136.8	von Willebrand factor type A domain
8	PF13519 VWA_2	1.5e-10	53.1	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379350	0.999	Integrin beta-1
2	9606.ENSP00000452786	0.977	Integrin beta-3
3	9606.ENSP00000346839	0.973	Fibronectin type III domain containing
4	9606.ENSP00000296181	0.968	Integrin beta-5
5	9606.ENSP00000225964	0.966	Collagen alpha-1(I) chain
6	9606.ENSP00000283249	0.965	Integrin beta-6
7	9606.ENSP00000297268	0.963	Collagen alpha-2(I) chain
8	9606.ENSP00000374309	0.961	Laminin subunit alpha-1
9	9606.ENSP00000222573	0.959	Integrin beta-8
10	9606.ENSP00000380948	0.959	Integrin beta-2
11	9606.ENSP00000341189	0.958	Focal adhesion kinase 1
12	9606.ENSP00000267082	0.955	Integrin beta-7
13	9606.ENSP00000304408	0.950	Collagen alpha-1(III) chain
14	9606.ENSP00000324532	0.947	Laminin subunit alpha-3
15	9606.ENSP00000364979	0.947	Collagen alpha-1(IV) chain
16	9606.ENSP00000359114	0.945	Collagen alpha-1(XI) chain
17	9606.ENSP00000222399	0.944	Laminin subunit beta-1
18	9606.ENSP00000264144	0.943	Laminin subunit gamma-2
19	9606.ENSP00000303939	0.943	Cytotoxic T-lymphocyte protein 4
20	9606.ENSP00000375778	0.943	Laminin subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0005518	1.000	collagen binding
GO:0060089	0.953	molecular transducer activity
GO:0004888	0.933	transmembrane signaling receptor activity
GO:0098631	0.738	cell adhesion mediator activity
GO:0005102	0.652	signaling receptor binding
GO:0097367	0.592	carbohydrate derivative binding
GO:1901681	0.579	sulfur compound binding
GO:0043394	0.474	proteoglycan binding
GO:0043395	0.455	heparan sulfate proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0032501	0.993	multicellular organismal process
GO:0048856	0.991	anatomical structure development
GO:0050896	0.990	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0007155	0.983	cell adhesion
GO:0007160	0.960	cell-matrix adhesion
GO:0030154	0.958	cell differentiation
GO:0007275	0.953	multicellular organism development
GO:0051716	0.945	cellular response to stimulus
GO:0009653	0.936	anatomical structure morphogenesis
GO:0009888	0.931	tissue development
GO:0048518	0.870	positive regulation of biological process
GO:0042060	0.850	wound healing
GO:0007154	0.847	cell communication
GO:0048870	0.839	cell motility
GO:0023052	0.837	signaling
GO:0016477	0.831	cell migration
GO:0007165	0.821	signal transduction
GO:0048522	0.756	positive regulation of cellular process
GO:0019222	0.544	regulation of metabolic process
GO:0007166	0.515	cell surface receptor signaling pathway
GO:0048513	0.501	animal organ development
GO:0048583	0.475	regulation of response to stimulus
GO:0060255	0.465	regulation of macromolecule metabolic process
GO:0031323	0.453	regulation of cellular metabolic process
GO:0009893	0.446	positive regulation of metabolic process
GO:0051239	0.437	regulation of multicellular organismal process
GO:0010604	0.422	positive regulation of macromolecule metabolic process
GO:0080090	0.420	regulation of primary metabolic process
GO:0051171	0.415	regulation of nitrogen compound metabolic process
GO:0098609	0.407	cell-cell adhesion
GO:0010646	0.398	regulation of cell communication
GO:0048523	0.377	negative regulation of cellular process
GO:0048646	0.369	anatomical structure formation involved in morphogenesis
GO:0065008	0.358	regulation of biological quality
GO:0071840	0.340	cellular component organization or biogenesis
GO:0023051	0.336	regulation of signaling
GO:0048584	0.331	positive regulation of response to stimulus
GO:0030335	0.320	positive regulation of cell migration
GO:0001704	0.318	formation of primary germ layer
GO:0016043	0.311	cellular component organization
GO:0009966	0.310	regulation of signal transduction
GO:0050878	0.306	regulation of body fluid levels
GO:0042221	0.302	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.999	cell surface
GO:0032991	0.992	protein-containing complex
GO:0030054	0.989	cell junction
GO:0043235	0.981	receptor complex
GO:0070161	0.980	anchoring junction
GO:0098796	0.979	membrane protein complex
GO:0098636	0.977	protein complex involved in cell adhesion
GO:0043226	0.974	organelle
GO:0098802	0.974	plasma membrane signaling receptor complex
GO:0030055	0.967	cell-substrate junction
GO:0043227	0.963	membrane-bounded organelle
GO:0008305	0.961	integrin complex
GO:0005925	0.955	focal adhesion
GO:0005576	0.949	extracellular region
GO:0005622	0.938	intracellular anatomical structure
GO:0031982	0.920	vesicle
GO:0005615	0.898	extracellular space
GO:0043231	0.878	intracellular membrane-bounded organelle
GO:0005737	0.858	cytoplasm
GO:0070062	0.790	extracellular exosome
GO:0012505	0.680	endomembrane system
GO:0097708	0.578	intracellular vesicle
GO:0031410	0.574	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]