StarFunc result for job id P17302

User Input

>input (382 residues)
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG
VNVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A654IBU3	0.698	0.698	7.096E-53	382	1.000	1.000	A0A654IBU3.pdb.gz	A0A654IBU3_HUMAN Gap junction protein OS=Homo sapiens OX=9606 GN=CXNK2 PE=3 SV=1
2	AFDB:P16863	0.807	0.813	1.189E-49	379	0.861	0.868	P16863.pdb.gz	CXA1_XENLA Gap junction alpha-1 protein OS=Xenopus laevis OX=8355 GN=gja1 PE=2 SV=2
3	AFDB:O57474	0.781	0.783	3.669E-47	381	0.796	0.798	O57474.pdb.gz	CXA1_DANRE Gap junction alpha-1 protein OS=Danio rerio OX=7955 GN=gja1 PE=1 SV=3
4	AFDB:E7FBZ4	0.636	0.685	2.823E-37	354	0.644	0.695	E7FBZ4.pdb.gz	E7FBZ4_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=LOC565638 PE=3 SV=1
5	AFDB:P28235	0.644	0.734	5.918E-29	333	0.406	0.465	P28235.pdb.gz	CXA4_MOUSE Gap junction alpha-4 protein OS=Mus musculus OX=10090 GN=Gja4 PE=1 SV=2
6	AFDB:P35212	0.642	0.731	2.317E-28	333	0.406	0.465	P35212.pdb.gz	CXA4_HUMAN Gap junction alpha-4 protein OS=Homo sapiens OX=9606 GN=GJA4 PE=1 SV=3
7	AFDB:B3DID2	0.556	0.574	2.172E-27	370	0.440	0.454	B3DID2.pdb.gz
8	AFDB:P36381	0.557	0.532	3.183E-27	400	0.414	0.395	P36381.pdb.gz	CXA8_CHICK Gap junction alpha-8 protein OS=Gallus gallus OX=9031 GN=GJA8 PE=1 SV=2
9	AFDB:Q8JFD2	0.568	0.501	3.361E-27	434	0.495	0.435	Q8JFD2.pdb.gz	Q8JFD2_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=cx48.5 PE=2 SV=1
10	AFDB:F1SDC3	0.584	0.621	4.664E-27	358	0.401	0.427	F1SDC3.pdb.gz	F1SDC3_PIG Gap junction protein OS=Sus scrofa OX=9823 GN=GJA5 PE=3 SV=1
11	PDB:7f92A	0.464	0.881	2.640E-26	196	0.510	0.995	7f92A.pdb.gz
12	PDB:7jkcA	0.485	0.929	3.303E-21	196	0.330	0.643	7jkcA.pdb.gz
13	PDB:7jjpA	0.485	0.929	3.852E-20	196	0.312	0.607	7jjpA.pdb.gz
14	PDB:2zw3A	0.472	0.870	9.893E-16	201	0.280	0.532	2zw3A.pdb.gz
15	PDB:6uvtA	0.387	0.816	1.868E-13	176	0.236	0.511	6uvtA.pdb.gz
16	PDB:6l3tA	0.438	0.808	2.200E-13	201	0.194	0.368	6l3tA.pdb.gz	Cryo-EM structure of human Cx31.3/GJC3 connexin hemichannel.
17	PDB:6m04A	0.387	0.220	4.567E-4	714	0.071	0.038	6m04A.pdb.gz
18	PDB:6m02A	0.326	0.364	6.692E-4	335	0.105	0.119	6m02A.pdb.gz
19	PDB:6uzyA	0.299	0.389	1.994E-3	278	0.099	0.137	6uzyA.pdb.gz	Cryo-EM structures of the ATP release channel pannexin 1.
20	PDB:6ltnA	0.251	0.364	2.224E-3	244	0.099	0.156	6ltnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A654IBU3	0.0	798	382	1.000	1.000	A0A654IBU3_HUMAN Gap junction protein OS=Homo sapiens OX=9606 GN=CXNK2 PE=3 SV=1
2	O57474	0.0	614	381	0.806	0.808	CXA1_DANRE Gap junction alpha-1 protein OS=Danio rerio OX=7955 GN=gja1 PE=1 SV=3
3	P08050	0.0	785	382	0.976	0.976	CXA1_RAT Gap junction alpha-1 protein OS=Rattus norvegicus OX=10116 GN=Gja1 PE=1 SV=2
4	P16863	0.0	682	379	0.861	0.868	CXA1_XENLA Gap junction alpha-1 protein OS=Xenopus laevis OX=8355 GN=gja1 PE=2 SV=2
5	P17302	0.0	798	382	1.000	1.000	CXA1_HUMAN Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2
6	P23242	0.0	783	382	0.974	0.974	CXA1_MOUSE Gap junction alpha-1 protein OS=Mus musculus OX=10090 GN=Gja1 PE=1 SV=2
7	Q29101	0.0	784	382	0.979	0.979	CXA1_PIG Gap junction alpha-1 protein OS=Sus scrofa OX=9823 GN=GJA1 PE=2 SV=2
8	Q6S9C0	0.0	773	382	0.966	0.966	CXA1_CANLF Gap junction alpha-1 protein OS=Canis lupus familiaris OX=9615 GN=GJA1 PE=2 SV=3
9	Q6TYA9	0.0	793	382	0.992	0.992	CXA1_CHLAE Gap junction alpha-1 protein OS=Chlorocebus aethiops OX=9534 GN=GJA1 PE=1 SV=1
10	E7FBZ4	4.30e-171	483	354	0.639	0.689	E7FBZ4_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=LOC565638 PE=3 SV=1
11	Q8JFD2	3.68e-103	313	434	0.490	0.431	Q8JFD2_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=cx48.5 PE=2 SV=1
12	Q03190	2.01e-101	305	333	0.411	0.471	CXA4_RAT Gap junction alpha-4 protein OS=Rattus norvegicus OX=10116 GN=Gja4 PE=2 SV=2
13	P28235	2.31e-101	305	333	0.414	0.474	CXA4_MOUSE Gap junction alpha-4 protein OS=Mus musculus OX=10090 GN=Gja4 PE=1 SV=2
14	Q3S2N4	2.86e-100	303	370	0.455	0.470	Q3S2N4_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=cx41.8 PE=2 SV=1
15	P35212	2.44e-98	297	333	0.406	0.465	CXA4_HUMAN Gap junction alpha-4 protein OS=Homo sapiens OX=9606 GN=GJA4 PE=1 SV=3
16	Q64448	1.36e-97	298	417	0.453	0.415	CXA3_MOUSE Gap junction alpha-3 protein OS=Mus musculus OX=10090 GN=Gja3 PE=2 SV=4
17	P29414	1.69e-97	298	416	0.455	0.418	CXA3_RAT Gap junction alpha-3 protein OS=Rattus norvegicus OX=10116 GN=Gja3 PE=1 SV=2
18	B0R0X0	3.95e-95	290	353	0.414	0.448	B0R0X0_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=cx39.9 PE=2 SV=1
19	Q9Y6H8	2.52e-94	290	435	0.461	0.405	CXA3_HUMAN Gap junction alpha-3 protein OS=Homo sapiens OX=9606 GN=GJA3 PE=1 SV=4
20	Q8AWR4	4.34e-94	287	353	0.411	0.445	Q8AWR4_DANRE Gap junction protein OS=Danio rerio OX=7955 GN=cx39.9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.9e+02	11.1	7 transmembrane receptor (rhodopsin family)
2	PF00909 Ammonium_transp	4.4e+02	10.9	Ammonium Transporter Family
3	PF00029 Connexin	5.4e-91	316.0	Connexin
4	PF16791 Connexin40_C	0.047	26.2	Connexin 40 C-terminal domain
5	PF03508 Connexin43	2.4e-40	148.0	Gap junction alpha-1 protein (Cx43)
6	PF13687 DUF4153	1.5e+02	13.0	Domain of unknown function (DUF4153)
7	PF19904 DUF6377	2.8e+02	12.5	Domain of unknown function (DUF6377)
8	PF04923 Ninjurin	3.4e+02	12.5	Ninjurin
9	PF15839 TEX29	8.3e+02	11.9	Testis-expressed sequence 29 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282561

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281537	0.999	Tight junction protein ZO-1
2	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000269141	0.998	Cadherin-2
4	9606.ENSP00000344456	0.998	Catenin beta-1
5	9606.ENSP00000424827	0.997	E3 ubiquitin-protein ligase NEDD4
6	9606.ENSP00000357292	0.995	Ubiquilin-4
7	9606.ENSP00000360798	0.992	Epidermal growth factor receptor substrate 15
8	9606.ENSP00000070846	0.991	Plakophilin-2
9	9606.ENSP00000292385	0.989	Drebrin
10	9606.ENSP00000410257	0.985	Sodium channel protein type 5 subunit alpha
11	9606.ENSP00000204961	0.980	Ephrin-B1
12	9606.ENSP00000259526	0.980	Protein NOV homolog
13	9606.ENSP00000438262	0.980	Tight junction protein ZO-2
14	9606.ENSP00000240662	0.978	ATP-sensitive inward rectifier potassium channel 8
15	9606.ENSP00000339191	0.973	Caveolin-1
16	9606.ENSP00000349960	0.963	Actin, cytoplasmic 1
17	9606.ENSP00000378217	0.962	Protein kinase C delta type
18	9606.ENSP00000293379	0.956	Integrin alpha-5
19	9606.ENSP00000382004	0.954	Catenin delta-1
20	9606.ENSP00000365745	0.947	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005243	1.000	gap junction channel activity
GO:0055077	0.520	gap junction hemi-channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0007154	0.995	cell communication
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0050896	0.987	response to stimulus
GO:0032501	0.986	multicellular organismal process
GO:0048856	0.968	anatomical structure development
GO:0044057	0.968	regulation of system process
GO:0048522	0.961	positive regulation of cellular process
GO:1903522	0.913	regulation of blood circulation
GO:0008016	0.890	regulation of heart contraction
GO:0007275	0.889	multicellular organism development
GO:0030334	0.880	regulation of cell migration
GO:0048513	0.872	animal organ development
GO:0023052	0.864	signaling
GO:0051179	0.862	localization
GO:0008015	0.860	blood circulation
GO:0051716	0.851	cellular response to stimulus
GO:0032879	0.842	regulation of localization
GO:0070848	0.839	response to growth factor
GO:0048523	0.837	negative regulation of cellular process
GO:0060255	0.831	regulation of macromolecule metabolic process
GO:0009611	0.829	response to wounding
GO:0065008	0.828	regulation of biological quality
GO:0051234	0.821	establishment of localization
GO:0009888	0.797	tissue development
GO:0048869	0.785	cellular developmental process
GO:0030154	0.779	cell differentiation
GO:0048731	0.776	system development
GO:0048583	0.770	regulation of response to stimulus
GO:0071840	0.768	cellular component organization or biogenesis
GO:0003012	0.768	muscle system process
GO:0050793	0.762	regulation of developmental process
GO:0016043	0.758	cellular component organization
GO:0042127	0.750	regulation of cell population proliferation
GO:0006810	0.715	transport
GO:0009893	0.701	positive regulation of metabolic process
GO:0080090	0.693	regulation of primary metabolic process
GO:0009653	0.684	anatomical structure morphogenesis
GO:0051240	0.682	positive regulation of multicellular organismal process
GO:0051171	0.677	regulation of nitrogen compound metabolic process
GO:0007165	0.637	signal transduction
GO:0072359	0.619	circulatory system development
GO:0002931	0.607	response to ischemia
GO:0010468	0.602	regulation of gene expression
GO:0010604	0.598	positive regulation of macromolecule metabolic process
GO:0048468	0.582	cell development
GO:0031323	0.576	regulation of cellular metabolic process
GO:0071495	0.564	cellular response to endogenous stimulus
GO:0007507	0.550	heart development
GO:0048870	0.541	cell motility
GO:0040017	0.518	positive regulation of locomotion
GO:0010646	0.487	regulation of cell communication
GO:0042221	0.485	response to chemical
GO:0014910	0.470	regulation of smooth muscle cell migration
GO:2000026	0.442	regulation of multicellular organismal development
GO:0008283	0.412	cell population proliferation
GO:0048584	0.409	positive regulation of response to stimulus
GO:0035107	0.399	appendage morphogenesis
GO:0048598	0.398	embryonic morphogenesis
GO:0061337	0.354	cardiac conduction
GO:0051049	0.353	regulation of transport
GO:0019219	0.340	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0031326	0.326	regulation of cellular biosynthetic process
GO:0010556	0.323	regulation of macromolecule biosynthetic process
GO:0023051	0.322	regulation of signaling
GO:0008284	0.308	positive regulation of cell population proliferation
GO:0030335	0.302	positive regulation of cell migration
GO:0007267	0.300	cell-cell signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0070161	0.997	anchoring junction
GO:0043227	0.990	membrane-bounded organelle
GO:0043229	0.988	intracellular organelle
GO:0005911	0.986	cell-cell junction
GO:0032991	0.985	protein-containing complex
GO:0005921	0.978	gap junction
GO:0005737	0.977	cytoplasm
GO:0005634	0.969	nucleus
GO:0012505	0.936	endomembrane system
GO:0031974	0.790	membrane-enclosed lumen
GO:0070013	0.776	intracellular organelle lumen
GO:0031981	0.715	nuclear lumen
GO:0098796	0.626	membrane protein complex
GO:0098797	0.589	plasma membrane protein complex
GO:0005654	0.497	nucleoplasm
GO:0005922	0.326	connexin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]