StarFunc result for job id P17342

User Input

>input (541 residues)
MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLP
QDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRV
AAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPA
YAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETK
DLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDG
SWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEG
FHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLE
ESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSV
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17342	1.000	1.000	1.251E-102	541	1.000	1.000	P17342.pdb.gz	ANPRC_HUMAN Atrial natriuretic peptide receptor 3 OS=Homo sapiens OX=9606 GN=NPR3 PE=1 SV=2
2	AFDB:A0A2R8RSJ1	0.731	0.785	7.317E-63	503	0.508	0.547	A0A2R8RSJ1.pdb.gz	A0A2R8RSJ1_DANRE Atrial natriuretic peptide receptor 3 isoform X1 OS=Danio rerio OX=7955 GN=im:7138418 PE=1 SV=1
3	AFDB:E7F3T9	0.716	0.376	1.978E-41	1065	0.275	0.140	E7F3T9.pdb.gz
4	AFDB:P16066	0.712	0.373	2.928E-40	1061	0.287	0.146	P16066.pdb.gz	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
5	AFDB:Q1LX84	0.709	0.372	3.665E-40	1067	0.270	0.137	Q1LX84.pdb.gz	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
6	AFDB:P16067	0.696	0.375	7.183E-39	1047	0.259	0.134	P16067.pdb.gz	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
7	AFDB:A0A0G2KGK2	0.690	0.369	2.762E-37	1051	0.253	0.130	A0A0G2KGK2.pdb.gz
8	AFDB:Q86GV3	0.673	0.298	8.475E-35	1276	0.257	0.109	Q86GV3.pdb.gz	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
9	AFDB:P55205	0.627	0.325	1.116E-27	1100	0.170	0.084	P55205.pdb.gz	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
10	AFDB:Q6TL19	0.620	0.326	2.740E-27	1100	0.168	0.083	Q6TL19.pdb.gz	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
11	PDB:7c7sA	0.601	0.483	8.943E-23	685	0.137	0.108	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
12	PDB:6w2xB	0.551	0.455	3.847E-21	669	0.161	0.130	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
13	PDB:7e9gR	0.527	0.389	7.963E-18	769	0.137	0.096	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
14	PDB:7epcA	0.576	0.410	2.068E-17	782	0.142	0.098	7epcA.pdb.gz
15	PDB:7e9hR	0.506	0.373	4.801E-17	766	0.142	0.101	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
16	PDB:7epaA	0.563	0.402	5.371E-17	782	0.144	0.100	7epaA.pdb.gz
17	PDB:7wihA	0.488	0.372	1.179E-16	741	0.122	0.089	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
18	PDB:5kbtA	0.529	0.311	2.186E-16	973	0.102	0.057	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
19	PDB:4tllA	0.473	0.349	3.425E-16	767	0.111	0.078	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
20	PDB:4u1xC	0.503	0.374	3.425E-16	755	0.100	0.072	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RSJ1	0.0	533	503	0.506	0.545	A0A2R8RSJ1_DANRE Atrial natriuretic peptide receptor 3 isoform X1 OS=Danio rerio OX=7955 GN=im:7138418 PE=1 SV=1
2	A2RUY7	0.0	525	472	0.495	0.568	A2RUY7_DANRE Atrial natriuretic peptide receptor 3 OS=Danio rerio OX=7955 GN=si:dkey-199l1.2 PE=1 SV=1
3	P17342	0.0	1118	541	1.000	1.000	ANPRC_HUMAN Atrial natriuretic peptide receptor 3 OS=Homo sapiens OX=9606 GN=NPR3 PE=1 SV=2
4	P41740	0.0	986	535	0.904	0.914	ANPRC_RAT Atrial natriuretic peptide receptor 3 OS=Rattus norvegicus OX=10116 GN=Npr3 PE=2 SV=1
5	P70180	0.0	997	536	0.908	0.916	ANPRC_MOUSE Atrial natriuretic peptide receptor 3 OS=Mus musculus OX=10090 GN=Npr3 PE=1 SV=3
6	Q1LX84	1.17e-64	229	1067	0.261	0.132	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
7	P16066	3.19e-63	226	1061	0.305	0.156	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
8	P18293	6.93e-63	224	1057	0.285	0.146	ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2
9	P18910	1.06e-62	224	1057	0.285	0.146	ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1
10	P16067	9.31e-56	204	1047	0.274	0.141	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
11	Q6VVW5	2.82e-55	202	1047	0.272	0.140	ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2
12	P20594	2.90e-54	199	1047	0.259	0.134	ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1
13	Q86GV3	3.18e-47	179	1276	0.246	0.104	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
14	P55205	1.12e-16	86.3	1100	0.176	0.086	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
15	Q6TL19	2.48e-15	81.6	1100	0.177	0.087	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
16	Q8IQK2	5.39e-11	68.2	1248	0.139	0.060	Q8IQK2_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
17	Q9VU79	6.13e-11	67.8	1250	0.139	0.060	Q9VU79_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
18	M9NFA6	6.38e-11	67.8	1235	0.139	0.061	M9NFA6_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10738 PE=3 SV=1
19	C7LAF5	6.55e-11	67.8	1237	0.139	0.061	C7LAF5_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=CG10738-RA PE=2 SV=1
20	Q9XTY1	4.21e-10	65.1	1058	0.129	0.066	GCY22_CAEEL Receptor-type guanylate cyclase gcy-22 OS=Caenorhabditis elegans OX=6239 GN=gcy-22 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	2.5e-50	183.2	Receptor family ligand binding region
2	PF05808 Podoplanin	1.9e+02	13.8	Podoplanin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365663	0.999	Natriuretic peptides A
2	9606.ENSP00000365651	0.996	Natriuretic peptides B
3	9606.ENSP00000387159	0.994	C-type natriuretic peptide
4	9606.ENSP00000349493	0.956	Guanylin
5	9606.ENSP00000358857	0.891	Emerin
6	9606.ENSP00000342356	0.885	Osteocrin
7	9606.ENSP00000261170	0.768	Heat-stable enterotoxin receptor
8	9606.ENSP00000361662	0.764	Guanylate cyclase activator 2B
9	9606.ENSP00000394842	0.764	Grancalcin
10	9606.ENSP00000264399	0.724	cGMP-dependent protein kinase 2
11	9606.ENSP00000347742	0.704	Na(+)/H(+) exchange regulatory cofactor NHE-RF4
12	9606.ENSP00000443168	0.695	Saitohin
13	9606.ENSP00000263025	0.658	Mitogen-activated protein kinase 3
14	9606.ENSP00000418525	0.653	Neprilysin
15	9606.ENSP00000256190	0.648	Myotubularin-related protein 13
16	9606.ENSP00000261654	0.646	Adhesion G-protein coupled receptor D1
17	9606.ENSP00000356581	0.643	Adhesion G-protein coupled receptor G6
18	9606.ENSP00000230361	0.638	Guanylyl cyclase-activating protein 2
19	9606.ENSP00000363092	0.628	cGMP-dependent protein kinase 1
20	9606.ENSP00000344401	0.604	Protein lin-28 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0001653	0.999	peptide receptor activity
GO:0017046	0.999	peptide hormone binding
GO:0043167	0.900	ion binding
GO:0043168	0.797	anion binding
GO:0016941	0.779	natriuretic peptide receptor activity
GO:0046983	0.754	protein dimerization activity
GO:0031404	0.715	chloride ion binding
GO:0042803	0.713	protein homodimerization activity
GO:0004888	0.476	transmembrane signaling receptor activity
GO:0004930	0.409	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.993	cellular process
GO:0050896	0.992	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0003013	0.991	circulatory system process
GO:0065008	0.986	regulation of biological quality
GO:0008015	0.981	blood circulation
GO:0050878	0.980	regulation of body fluid levels
GO:0048519	0.976	negative regulation of biological process
GO:0008217	0.974	regulation of blood pressure
GO:0048856	0.945	anatomical structure development
GO:0042127	0.945	regulation of cell population proliferation
GO:0007186	0.902	G protein-coupled receptor signaling pathway
GO:0031279	0.889	regulation of cyclase activity
GO:0007275	0.870	multicellular organism development
GO:0051339	0.861	regulation of lyase activity
GO:0045761	0.823	regulation of adenylate cyclase activity
GO:0048731	0.817	system development
GO:0051239	0.816	regulation of multicellular organismal process
GO:0035556	0.778	intracellular signal transduction
GO:0048523	0.750	negative regulation of cellular process
GO:0019222	0.638	regulation of metabolic process
GO:0072359	0.576	circulatory system development
GO:0048771	0.550	tissue remodeling
GO:0003014	0.509	renal system process
GO:0007188	0.365	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0008283	0.317	cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.927	organelle
GO:0005576	0.903	extracellular region
GO:0043227	0.892	membrane-bounded organelle
GO:0032991	0.889	protein-containing complex
GO:0031982	0.715	vesicle
GO:0005622	0.671	intracellular anatomical structure
GO:0043229	0.653	intracellular organelle
GO:0005615	0.581	extracellular space
GO:0070062	0.527	extracellular exosome
GO:0005737	0.314	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]