StarFunc result for job id P17481

User Input

>input (243 residues)
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHG
PSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGE
EAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVS
HALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKG
DKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09632	0.892	0.892	1.198E-34	243	0.984	0.984	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
2	AFDB:Q8AWZ0	0.601	0.598	7.230E-28	245	0.794	0.788	Q8AWZ0.pdb.gz	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
3	AFDB:P09025	0.339	0.338	1.344E-20	242	0.617	0.620	P09025.pdb.gz	HXC8_MOUSE Homeobox protein Hox-C8 OS=Mus musculus OX=10090 GN=Hoxc8 PE=1 SV=2
4	AFDB:P23463	0.364	0.309	5.989E-17	289	0.609	0.512	P23463.pdb.gz	HXD8_MOUSE Homeobox protein Hox-D8 OS=Mus musculus OX=10090 GN=Hoxd8 PE=3 SV=4
5	AFDB:P09023	0.314	0.338	6.916E-11	224	0.374	0.406	P09023.pdb.gz	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
6	AFDB:Q8T940	0.333	0.320	4.711E-10	253	0.317	0.304	Q8T940.pdb.gz	UBX_JUNCO Homeotic protein ultrabithorax OS=Junonia coenia OX=39708 GN=Ubx PE=2 SV=1
7	AFDB:F1RBA3	0.280	0.276	6.218E-9	246	0.272	0.268	F1RBA3.pdb.gz
8	AFDB:O42366	0.302	0.239	5.518E-8	311	0.276	0.215	O42366.pdb.gz	HXB1A_DANRE Homeobox protein Hox-B1a OS=Danio rerio OX=7955 GN=hoxb1a PE=2 SV=2
9	AFDB:P09027	0.327	0.192	5.518E-8	433	0.284	0.159	P09027.pdb.gz	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
10	AFDB:A5PLE8	0.276	0.264	6.730E-8	255	0.263	0.251	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
11	PDB:4egcA	0.180	0.081	1.004E-2	539	0.066	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.201	0.594	4.305E-2	73	0.070	0.233	2hi3A.pdb.gz
13	PDB:7w59R	0.111	0.098	6.930E-1	280	0.082	0.071	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
14	PDB:7fbyA	0.152	0.228	8.452E-1	153	0.033	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:4v88Ah	0.101	0.139	1.343	159	0.078	0.119	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
16	PDB:5datSM	0.104	0.155	1.343	159	0.086	0.132	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
17	PDB:5nr5A	0.161	0.321	1.435	113	0.062	0.133	5nr5A.pdb.gz
18	PDB:2cg4A	0.160	0.250	1.997	149	0.016	0.027	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:5mrc66	0.180	0.153	2.280	305	0.058	0.046	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
20	PDB:2h09A	0.116	0.205	2.781	127	0.025	0.047	2h09A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3L3R1	0.0	499	242	0.996	1.000	I3L3R1_HUMAN Homeobox B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=1
2	P09632	0.0	500	243	0.984	0.984	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
3	P17481	0.0	506	243	1.000	1.000	HXB8_HUMAN Homeobox protein Hox-B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=2
4	Q8AWZ0	2.19e-143	402	245	0.786	0.780	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
5	P31273	1.96e-97	286	242	0.605	0.607	HXC8_HUMAN Homeobox protein Hox-C8 OS=Homo sapiens OX=9606 GN=HOXC8 PE=1 SV=2
6	P09025	4.76e-97	285	242	0.605	0.607	HXC8_MOUSE Homeobox protein Hox-C8 OS=Mus musculus OX=10090 GN=Hoxc8 PE=1 SV=2
7	Q68EH7	9.93e-95	280	250	0.584	0.568	HXC8A_DANRE Homeobox protein Hox-C8a OS=Danio rerio OX=7955 GN=hoxc8a PE=2 SV=1
8	P23463	6.90e-83	251	289	0.580	0.488	HXD8_MOUSE Homeobox protein Hox-D8 OS=Mus musculus OX=10090 GN=Hoxd8 PE=3 SV=4
9	P13378	1.98e-82	249	290	0.597	0.500	HXD8_HUMAN Homeobox protein Hox-D8 OS=Homo sapiens OX=9606 GN=HOXD8 PE=1 SV=2
10	I3L383	2.18e-60	188	128	0.374	0.711	I3L383_HUMAN Homeobox B8 (Fragment) OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=1
11	P09629	5.14e-40	139	217	0.374	0.419	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
12	P02830	8.00e-39	136	229	0.387	0.410	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
13	P09024	8.78e-39	135	217	0.366	0.410	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
14	P31268	2.07e-38	135	230	0.379	0.400	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
15	P02833	7.64e-36	132	378	0.263	0.169	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
16	P09630	3.23e-32	119	235	0.230	0.238	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
17	P10629	3.23e-32	119	235	0.230	0.238	HXC6_MOUSE Homeobox protein Hox-C6 OS=Mus musculus OX=10090 GN=Hoxc6 PE=2 SV=2
18	P09014	1.58e-31	119	275	0.379	0.335	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
19	P09023	3.13e-31	116	224	0.387	0.420	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
20	P31267	5.49e-31	116	233	0.230	0.240	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	11	17.3	Homeobox KN domain
2	PF00046 Homeodomain	2e-18	77.3	Homeodomain
3	PF14978 MRP-63	2.3e+02	13.7	Mitochondrial ribosome protein 63

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006832564.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006876575.1	0.884	pre-B-cell leukemia transcription factor 1 isoform X1
2	185453.XP_006864581.1	0.609	Heart- and neural crest derivatives-expressed protein 2
3	185453.XP_006834835.1	0.598	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 21 Proteins
4	185453.XP_006875617.1	0.598	pre-B-cell leukemia transcription factor 2 isoform X1
5	185453.XP_006832566.1	0.543	Homeobox protein Hox-B5
6	185453.XP_006867580.1	0.532	Disks large-associated protein 3
7	185453.XP_006831853.1	0.520	Homeobox protein Meis2-like isoform X1
8	185453.XP_006863009.1	0.520	Homeobox protein Meis2-like isoform X1
9	185453.XP_006832072.1	0.507	SLIT and NTRK-like protein 5-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0000981	0.991	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.991	double-stranded DNA binding
GO:1990837	0.982	sequence-specific double-stranded DNA binding
GO:0000976	0.809	transcription cis-regulatory region binding
GO:0001217	0.759	DNA-binding transcription repressor activity
GO:0000977	0.743	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.741	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.990	developmental process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0048856	0.978	anatomical structure development
GO:0019222	0.970	regulation of metabolic process
GO:0032501	0.968	multicellular organismal process
GO:0007275	0.947	multicellular organism development
GO:0010468	0.921	regulation of gene expression
GO:0009889	0.914	regulation of biosynthetic process
GO:0031323	0.905	regulation of cellular metabolic process
GO:0006355	0.895	regulation of DNA-templated transcription
GO:0048731	0.874	system development
GO:0006357	0.863	regulation of transcription by RNA polymerase II
GO:0009653	0.739	anatomical structure morphogenesis
GO:0048513	0.729	animal organ development
GO:0009987	0.676	cellular process
GO:0048518	0.472	positive regulation of biological process
GO:0007389	0.415	pattern specification process
GO:0009790	0.376	embryo development
GO:0048519	0.366	negative regulation of biological process
GO:0048522	0.356	positive regulation of cellular process
GO:0009892	0.356	negative regulation of metabolic process
GO:0010604	0.344	positive regulation of macromolecule metabolic process
GO:0031324	0.344	negative regulation of cellular metabolic process
GO:0051172	0.333	negative regulation of nitrogen compound metabolic process
GO:0051173	0.330	positive regulation of nitrogen compound metabolic process
GO:0031325	0.322	positive regulation of cellular metabolic process
GO:0010605	0.315	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.342	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]