StarFunc result for job id P17509

User Input

>input (224 residues)
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYP
PAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEE
QKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIA
HALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09023	0.581	0.581	5.521E-30	224	0.951	0.951	P09023.pdb.gz	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
2	AFDB:Q8AWZ0	0.365	0.341	1.248E-10	245	0.420	0.384	Q8AWZ0.pdb.gz	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
3	AFDB:P09632	0.360	0.336	2.260E-10	243	0.402	0.370	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
4	AFDB:P02833	0.310	0.187	3.588E-10	378	0.375	0.222	P02833.pdb.gz	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
5	AFDB:P09025	0.336	0.315	4.991E-10	242	0.388	0.360	P09025.pdb.gz	HXC8_MOUSE Homeobox protein Hox-C8 OS=Mus musculus OX=10090 GN=Hoxc8 PE=1 SV=2
6	AFDB:P13378	0.316	0.247	1.764E-8	290	0.371	0.286	P13378.pdb.gz	HXD8_HUMAN Homeobox protein Hox-D8 OS=Homo sapiens OX=9606 GN=HOXD8 PE=1 SV=2
7	AFDB:F1RBA3	0.304	0.278	4.749E-8	246	0.268	0.244	F1RBA3.pdb.gz
8	AFDB:Q8AXR4	0.321	0.317	5.073E-8	228	0.290	0.285	Q8AXR4.pdb.gz	Q8AXR4_DANRE Caudal type homeobox 1a OS=Danio rerio OX=7955 GN=cdx2 PE=2 SV=2
9	AFDB:P83949	0.347	0.207	9.818E-8	389	0.366	0.211	P83949.pdb.gz	UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster OX=7227 GN=Ubx PE=1 SV=1
10	AFDB:A0A024RAZ6	0.311	0.270	1.197E-7	260	0.312	0.269	A0A024RAZ6.pdb.gz
11	PDB:4egcA	0.195	0.081	9.605E-3	539	0.067	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.216	0.598	5.710E-2	73	0.071	0.219	2hi3A.pdb.gz
13	PDB:5nr5A	0.179	0.323	9.763E-1	113	0.049	0.097	5nr5A.pdb.gz
14	PDB:7fbyA	0.164	0.227	9.763E-1	153	0.031	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5aj0BZ	0.179	0.407	2.156	86	0.049	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:1yioA	0.146	0.163	2.628	198	0.040	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:2rvqD	0.066	0.107	3.204	129	0.098	0.171	2rvqD.pdb.gz
18	PDB:2cg4A	0.172	0.250	3.656	149	0.022	0.034	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:4ldzA	0.168	0.187	3.906	196	0.040	0.046	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
20	PDB:6dv9F	0.074	0.094	3.906	174	0.058	0.075	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17509	2.96e-168	464	224	1.000	1.000	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
2	P09023	3.32e-164	453	224	0.978	0.978	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
3	P31267	1.75e-78	237	233	0.589	0.567	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
4	P09092	4.84e-78	236	232	0.585	0.565	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2
5	P09630	8.22e-59	187	235	0.482	0.460	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
6	P10629	8.22e-59	187	235	0.482	0.460	HXC6_MOUSE Homeobox protein Hox-C6 OS=Mus musculus OX=10090 GN=Hoxc6 PE=2 SV=2
7	P20719	4.12e-42	145	270	0.281	0.233	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
8	P09021	4.59e-42	145	270	0.281	0.233	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
9	P09629	2.62e-41	142	217	0.424	0.438	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
10	P02830	2.76e-41	142	229	0.451	0.441	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
11	P09079	1.98e-40	141	269	0.277	0.230	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
12	P09067	2.00e-40	141	269	0.277	0.230	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
13	P09013	2.54e-40	141	276	0.277	0.225	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
14	P09014	3.41e-40	140	275	0.277	0.225	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
15	P09024	4.67e-40	138	217	0.371	0.382	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
16	P52949	1.74e-39	137	233	0.259	0.249	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
17	P31268	2.78e-39	137	230	0.286	0.278	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
18	P02833	1.91e-37	136	378	0.299	0.177	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
19	P09077	5.85e-37	135	417	0.277	0.149	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
20	P32043	3.44e-36	129	222	0.259	0.261	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09974 DUF2209	2.3e+02	13.5	Uncharacterized protein conserved in archaea (DUF2209)
2	PF05920 Homeobox_KN	2.7e+02	12.9	Homeobox KN domain
3	PF00046 Homeodomain	2.5e-18	77.0	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420009

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000239151	0.944	Homeobox protein Hox-B5
2	9606.ENSP00000239165	0.894	Homeobox protein Hox-B7
3	9606.ENSP00000328928	0.880	Homeobox protein Hox-B4
4	9606.ENSP00000222726	0.855	Homeobox protein Hox-A5
5	9606.ENSP00000242159	0.844	Homeobox protein Hox-A7
6	9606.ENSP00000309336	0.843	Homeobox protein Hox-C5
7	9606.ENSP00000399808	0.840	Homeobox protein Hox-C4
8	9606.ENSP00000243108	0.837	Homeobox protein Hox-C6
9	9606.ENSP00000302548	0.834	Homeobox protein Hox-D4
10	9606.ENSP00000222728	0.827	Homeobox protein Hox-A6
11	9606.ENSP00000476742	0.807	Uncharacterized protein
12	9606.ENSP00000405890	0.652	Pre-B-cell leukemia transcription factor 1
13	9606.ENSP00000053867	0.607	Granulins
14	9606.ENSP00000452786	0.602	Integrin beta-3
15	9606.ENSP00000228641	0.570	Myogenic factor 6
16	9606.ENSP00000367828	0.549	Integral membrane protein 2B
17	9606.ENSP00000262418	0.538	Band 3 anion transport protein
18	9606.ENSP00000354543	0.524	TSC22 domain family member 2
19	9606.ENSP00000272369	0.520	Homeobox protein Meis1
20	9606.ENSP00000262367	0.513	CREB-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0003690	0.995	double-stranded DNA binding
GO:1990837	0.994	sequence-specific double-stranded DNA binding
GO:0003700	0.976	DNA-binding transcription factor activity
GO:0000981	0.910	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.808	transcription cis-regulatory region binding
GO:0000977	0.795	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.547	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.389	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.378	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.986	anatomical structure development
GO:0032501	0.976	multicellular organismal process
GO:0048706	0.967	embryonic skeletal system development
GO:0050789	0.949	regulation of biological process
GO:0050794	0.936	regulation of cellular process
GO:0007389	0.871	pattern specification process
GO:0009653	0.819	anatomical structure morphogenesis
GO:0048568	0.809	embryonic organ development
GO:0060255	0.805	regulation of macromolecule metabolic process
GO:0080090	0.797	regulation of primary metabolic process
GO:0031323	0.797	regulation of cellular metabolic process
GO:0051171	0.791	regulation of nitrogen compound metabolic process
GO:0003002	0.717	regionalization
GO:0010468	0.689	regulation of gene expression
GO:0031326	0.663	regulation of cellular biosynthetic process
GO:0010556	0.662	regulation of macromolecule biosynthetic process
GO:0051252	0.660	regulation of RNA metabolic process
GO:0006355	0.601	regulation of DNA-templated transcription
GO:0009987	0.583	cellular process
GO:0009952	0.424	anterior/posterior pattern specification
GO:0048598	0.408	embryonic morphogenesis
GO:0048705	0.392	skeletal system morphogenesis
GO:0006357	0.392	regulation of transcription by RNA polymerase II
GO:0048562	0.365	embryonic organ morphogenesis
GO:0048518	0.364	positive regulation of biological process
GO:0048704	0.349	embryonic skeletal system morphogenesis
GO:0048522	0.339	positive regulation of cellular process
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process
GO:0010604	0.309	positive regulation of macromolecule metabolic process
GO:0031325	0.301	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.751	cytoplasm
GO:0005829	0.722	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]