StarFunc result for job id P17535

User Input

>input (347 residues)
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17535	0.999	0.999	1.404E-49	347	1.000	1.000	P17535.pdb.gz	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3
2	AFDB:P15066	0.337	0.342	3.624E-35	341	0.818	0.833	P15066.pdb.gz	JUND_MOUSE Transcription factor JunD OS=Mus musculus OX=10090 GN=Jund PE=1 SV=1
3	AFDB:A8E7N0	0.283	0.301	1.621E-16	325	0.412	0.440	A8E7N0.pdb.gz
4	AFDB:F4I9R1	0.160	0.148	8.619E-2	374	0.173	0.160	F4I9R1.pdb.gz	F4I9R1_ARATH Basic-leucine zipper (BZIP) transcription factor family protein OS=Arabidopsis thaliana OX=3702 GN=At1g58110 PE=1 SV=1
5	AFDB:A0A2R8RYD3	0.178	0.072	1.071E-1	948	0.164	0.060	A0A2R8RYD3.pdb.gz
6	AFDB:Q84LG2	0.205	0.184	1.330E-1	389	0.182	0.162	Q84LG2.pdb.gz	BZP68_ARATH bZIP transcription factor 68 OS=Arabidopsis thaliana OX=3702 GN=BZIP68 PE=1 SV=1
7	AFDB:Q9VUL6	0.150	0.056	1.330E-1	1188	0.153	0.045	Q9VUL6.pdb.gz	Q9VUL6_DROME GH22749p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG12316 PE=2 SV=1
8	AFDB:Q38BR4	0.191	0.190	1.430E-1	349	0.110	0.109	Q38BR4.pdb.gz	Q38BR4_TRYB2 DDRGK domain-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4110 PE=4 SV=1
9	AFDB:Q9Y114	0.202	0.110	2.052E-1	656	0.133	0.070	Q9Y114.pdb.gz	Q9Y114_DROME BcDNA.GH10229 OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.24 PE=1 SV=1
10	AFDB:G5EG53	0.134	0.102	3.659E-1	468	0.196	0.145	G5EG53.pdb.gz	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1
11	PDB:6yxyBJ	0.113	0.129	2.398	293	0.037	0.044	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:4v88Ah	0.073	0.157	3.442	159	0.098	0.214	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
13	PDB:3jb9W	0.094	0.078	3.977	426	0.061	0.049	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:7f5sLC	0.116	0.110	4.596	368	0.052	0.049	7f5sLC.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
15	PDB:6yxxE8	0.111	0.229	5.311	154	0.049	0.110	6yxxE8.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:4ytpC	0.077	0.189	5.709	138	0.037	0.094	4ytpC.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
17	PDB:6gmlU	0.069	0.119	5.709	183	0.026	0.049	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
18	PDB:3jb9M	0.078	0.125	6.597	207	0.040	0.068	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:7rroD1	0.108	0.092	6.597	425	0.040	0.033	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:5dgesM	0.055	0.171	7.623	104	0.061	0.202	5dgesM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17535	0.0	672	347	1.000	1.000	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3
2	P15066	5.48e-152	432	341	0.795	0.809	JUND_MOUSE Transcription factor JunD OS=Mus musculus OX=10090 GN=Jund PE=1 SV=1
3	P52909	5.48e-152	432	341	0.795	0.809	JUND_RAT Transcription factor JunD OS=Rattus norvegicus OX=10116 GN=Jund PE=1 SV=1
4	Q6NZT5	3.19e-98	295	308	0.501	0.565	Q6NZT5_DANRE Jun proto-oncogene, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=c-Jun PE=2 SV=1
5	P05627	7.85e-97	292	334	0.530	0.551	JUN_MOUSE Transcription factor Jun OS=Mus musculus OX=10090 GN=Jun PE=1 SV=3
6	P17325	8.38e-97	292	334	0.530	0.551	JUN_RAT Transcription factor Jun OS=Rattus norvegicus OX=10116 GN=Jun PE=1 SV=1
7	P56432	1.34e-96	291	331	0.524	0.550	JUN_PIG Transcription factor Jun OS=Sus scrofa OX=9823 GN=JUN PE=2 SV=1
8	P18870	2.94e-96	290	314	0.487	0.538	JUN_CHICK Transcription factor Jun OS=Gallus gallus OX=9031 GN=JUN PE=1 SV=2
9	P05412	5.87e-96	290	331	0.524	0.550	JUN_HUMAN Transcription factor Jun OS=Homo sapiens OX=9606 GN=JUN PE=1 SV=2
10	Q2L4Q5	1.28e-88	271	327	0.490	0.520	Q2L4Q5_ONCMY Transcription factor AP-1 OS=Oncorhynchus mykiss OX=8022 GN=jun PE=2 SV=1
11	Q7T3E3	1.13e-77	242	310	0.441	0.494	Q7T3E3_DANRE Jun B proto-oncogene, like OS=Danio rerio OX=7955 GN=junbl PE=2 SV=1
12	Q7T367	4.19e-74	234	325	0.438	0.468	Q7T367_DANRE Jun B proto-oncogene OS=Danio rerio OX=7955 GN=junb PE=2 SV=1
13	P09450	7.01e-71	226	344	0.478	0.483	JUNB_MOUSE Transcription factor JunB OS=Mus musculus OX=10090 GN=Junb PE=1 SV=1
14	P24898	7.01e-71	226	344	0.478	0.483	JUNB_RAT Transcription factor JunB OS=Rattus norvegicus OX=10116 GN=Junb PE=1 SV=2
15	P17275	2.06e-63	207	347	0.395	0.395	JUNB_HUMAN Transcription factor JunB OS=Homo sapiens OX=9606 GN=JUNB PE=1 SV=1
16	Q5U079	2.06e-63	207	347	0.395	0.395	Q5U079_HUMAN Jun B proto-oncogene OS=Homo sapiens OX=9606 GN=JUNB PE=2 SV=1
17	Q4H3A1	2.62e-59	197	381	0.340	0.310	Q4H3A1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Jun PE=1 SV=1
18	A7RIQ6	3.00e-44	157	343	0.329	0.332	A7RIQ6_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g238589 PE=1 SV=1
19	P18289	1.86e-31	122	289	0.164	0.197	JRA_DROME Transcription factor Jra OS=Drosophila melanogaster OX=7227 GN=Jra PE=1 SV=2
20	A7RWP1	1.64e-29	112	135	0.150	0.385	A7RWP1_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g95962 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	1.6e-13	61.9	bZIP transcription factor
2	PF07716 bZIP_2	0.00014	33.2	Basic region leucine zipper
3	PF03131 bZIP_Maf	1.3e-05	36.9	bZIP Maf transcription factor
4	PF11932 DUF3450	7.4e+02	10.8	Protein of unknown function (DUF3450)
5	PF19579 FtsL_2	5.7e+02	11.8	Bacteriodetes cell division protein (FtsL-like)
6	PF03957 Jun	7.2e-74	260.1	Jun-like transcription factor
7	PF01166 TSC22	6.3e+02	12.0	TSC-22/dip/bun family
8	PF06005 ZapB	1.2e+02	14.6	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252818

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245919	0.999	Protein fosB
2	9606.ENSP00000264716	0.999	Fos-related antigen 2
3	9606.ENSP00000306245	0.999	Proto-oncogene c-Fos
4	9606.ENSP00000310170	0.999	Fos-related antigen 1
5	9606.ENSP00000337088	0.998	Menin
6	9606.ENSP00000252951	0.987	Hemoglobin subunit zeta
7	9606.ENSP00000263253	0.987	Histone acetyltransferase p300
8	9606.ENSP00000264110	0.983	Cyclic AMP-dependent transcription factor ATF-2
9	9606.ENSP00000378974	0.983	Mitogen-activated protein kinase 8
10	9606.ENSP00000394560	0.981	Mitogen-activated protein kinase 9
11	9606.ENSP00000344352	0.974	Cyclic AMP-dependent transcription factor ATF-3
12	9606.ENSP00000329357	0.971	Transcription factor Sp1
13	9606.ENSP00000303315	0.970	Transcription factor jun-B
14	9606.ENSP00000352157	0.970	Mitogen-activated protein kinase 10
15	9606.ENSP00000239938	0.959	Early growth response protein 1
16	9606.ENSP00000479618	0.951	Myc proto-oncogene protein
17	9606.ENSP00000360266	0.927	Transcription factor AP-1
18	9606.ENSP00000387699	0.919	Cyclic AMP-responsive element-binding protein 1
19	9606.ENSP00000419782	0.913	Cyclin-dependent-like kinase 5
20	9606.ENSP00000350359	0.911	Cyclic AMP-responsive element-binding protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0140110	0.999	transcription regulator activity
GO:0019899	0.971	enzyme binding
GO:0003700	0.955	DNA-binding transcription factor activity
GO:0000981	0.934	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.762	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.663	transcription factor binding
GO:0000977	0.530	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.511	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.473	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0009987	0.980	cellular process
GO:0048522	0.976	positive regulation of cellular process
GO:0051173	0.961	positive regulation of nitrogen compound metabolic process
GO:0031325	0.961	positive regulation of cellular metabolic process
GO:0010604	0.960	positive regulation of macromolecule metabolic process
GO:0006357	0.959	regulation of transcription by RNA polymerase II
GO:0045935	0.951	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.948	positive regulation of cellular biosynthetic process
GO:1903508	0.935	positive regulation of nucleic acid-templated transcription
GO:0050896	0.934	response to stimulus
GO:0045893	0.905	positive regulation of DNA-templated transcription
GO:0045944	0.886	positive regulation of transcription by RNA polymerase II
GO:0048523	0.868	negative regulation of cellular process
GO:0031327	0.804	negative regulation of cellular biosynthetic process
GO:0051716	0.790	cellular response to stimulus
GO:1902679	0.778	negative regulation of RNA biosynthetic process
GO:0045892	0.772	negative regulation of DNA-templated transcription
GO:0042221	0.660	response to chemical
GO:0008152	0.646	metabolic process
GO:0044237	0.543	cellular metabolic process
GO:0032502	0.531	developmental process
GO:0071704	0.529	organic substance metabolic process
GO:0044238	0.518	primary metabolic process
GO:0006807	0.515	nitrogen compound metabolic process
GO:0032501	0.487	multicellular organismal process
GO:0000122	0.458	negative regulation of transcription by RNA polymerase II
GO:0048856	0.441	anatomical structure development
GO:0043170	0.438	macromolecule metabolic process
GO:0010033	0.376	response to organic substance
GO:0006950	0.348	response to stress
GO:0070887	0.314	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005694	0.971	chromosome
GO:0000785	0.961	chromatin
GO:0140513	0.954	nuclear protein-containing complex
GO:0090575	0.909	RNA polymerase II transcription regulator complex
GO:0005829	0.768	cytosol
GO:0035976	0.496	transcription factor AP-1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]