StarFunc result for job id P17542

User Input

>input (331 residues)
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17542	0.999	0.999	1.608E-48	331	1.000	1.000	P17542.pdb.gz	TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 OS=Homo sapiens OX=9606 GN=TAL1 PE=1 SV=2
2	AFDB:O93507	0.256	0.260	1.513E-19	324	0.535	0.546	O93507.pdb.gz	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
3	AFDB:O73823	0.252	0.214	5.611E-19	394	0.486	0.409	O73823.pdb.gz	TAL1_XENLA T-cell acute lymphocytic leukemia protein 1 OS=Xenopus laevis OX=8355 GN=tal1 PE=2 SV=1
4	AFDB:R4GLV5	0.182	0.055	1.663E-4	1116	0.211	0.063	R4GLV5.pdb.gz
5	AFDB:A0A3Q7ELQ2	0.200	0.116	2.695E-4	613	0.160	0.086	A0A3Q7ELQ2.pdb.gz	MTB1_SOLLC Transcription factor MTB1 OS=Solanum lycopersicum OX=4081 GN=MTB1 PE=1 SV=1
6	AFDB:P56720	0.195	0.066	2.887E-4	1134	0.202	0.059	P56720.pdb.gz	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
7	AFDB:Q9Y4Z2	0.229	0.340	4.368E-4	214	0.184	0.285	Q9Y4Z2.pdb.gz	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
8	AFDB:A0A087X1T2	0.143	0.075	6.608E-4	654	0.196	0.099	A0A087X1T2.pdb.gz	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
9	AFDB:P70447	0.227	0.281	7.585E-4	263	0.199	0.251	P70447.pdb.gz	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
10	AFDB:Q56YJ8	0.262	0.220	8.707E-4	414	0.154	0.123	Q56YJ8.pdb.gz	FAMA_ARATH Transcription factor FAMA OS=Arabidopsis thaliana OX=3702 GN=FAMA PE=1 SV=1
11	PDB:3b0dC	0.133	0.506	8.948E-1	75	0.039	0.173	3b0dC.pdb.gz
12	PDB:6zx9C	0.089	0.108	3.098	257	0.048	0.062	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
13	PDB:7pj1B	0.104	0.243	3.098	122	0.051	0.139	7pj1B.pdb.gz
14	PDB:5z56A	0.099	0.020	5.021	2232	0.027	0.004	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:5z57A	0.099	0.022	5.021	1978	0.027	0.005	5z57A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:2bskD	0.097	0.267	6.176	90	0.054	0.200	2bskD.pdb.gz
17	PDB:7ktrE	0.095	0.204	6.617	124	0.048	0.129	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
18	PDB:5olwA	0.077	0.113	7.089	224	0.027	0.040	5olwA.pdb.gz	Observing enzyme ternary transition state analogue complexes by19F NMR spectroscopy.
19	PDB:7ktsD	0.139	0.203	7.596	219	0.021	0.032	7ktsD.pdb.gz
20	PDB:1qsdA	0.097	0.258	8.138	102	0.045	0.147	1qsdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17542	0.0	655	331	1.000	1.000	TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 OS=Homo sapiens OX=9606 GN=TAL1 PE=1 SV=2
2	P22091	0.0	514	329	0.931	0.936	TAL1_MOUSE T-cell acute lymphocytic leukemia protein 1 homolog OS=Mus musculus OX=10090 GN=Tal1 PE=1 SV=1
3	O73823	1.61e-100	303	394	0.492	0.414	TAL1_XENLA T-cell acute lymphocytic leukemia protein 1 OS=Xenopus laevis OX=8355 GN=tal1 PE=2 SV=1
4	O93507	4.86e-87	266	324	0.498	0.509	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
5	P27792	9.95e-39	140	278	0.227	0.270	LYL1_MOUSE Protein lyl-1 OS=Mus musculus OX=10090 GN=Lyl1 PE=2 SV=2
6	P12980	1.63e-38	140	280	0.218	0.257	LYL1_HUMAN Protein lyl-1 OS=Homo sapiens OX=9606 GN=LYL1 PE=1 SV=3
7	Q16559	3.11e-30	112	108	0.157	0.481	TAL2_HUMAN T-cell acute lymphocytic leukemia protein 2 OS=Homo sapiens OX=9606 GN=TAL2 PE=1 SV=1
8	F1QUD8	5.31e-30	112	109	0.145	0.440	F1QUD8_DANRE T-cell acute lymphocytic leukemia 2 OS=Danio rerio OX=7955 GN=zgc:111884 PE=4 SV=1
9	Q62282	4.17e-29	110	108	0.154	0.472	TAL2_MOUSE T-cell acute lymphocytic leukemia protein 2 homolog OS=Mus musculus OX=10090 GN=Tal2 PE=4 SV=1
10	Q64221	3.49e-14	70.9	135	0.100	0.244	HEN2_MOUSE Helix-loop-helix protein 2 OS=Mus musculus OX=10090 GN=Nhlh2 PE=1 SV=2
11	Q02577	3.56e-14	70.9	135	0.100	0.244	HEN2_HUMAN Helix-loop-helix protein 2 OS=Homo sapiens OX=9606 GN=NHLH2 PE=1 SV=1
12	Q02575	9.58e-14	69.3	133	0.100	0.248	HEN1_HUMAN Helix-loop-helix protein 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
13	Q5T203	9.58e-14	69.3	133	0.100	0.248	Q5T203_HUMAN Nescient helix loop helix 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
14	Q60756	1.75e-13	70.5	195	0.154	0.262	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
15	Q568M7	1.66e-12	67.0	169	0.097	0.189	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
16	Q9PTE3	2.43e-12	66.6	171	0.097	0.187	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
17	Q9D030	3.18e-12	65.9	160	0.100	0.206	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
18	P97831	3.62e-12	65.9	160	0.100	0.206	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
19	Q8WVJ9	3.62e-12	65.9	160	0.100	0.206	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
20	Q9PVG4	3.97e-12	66.2	190	0.097	0.168	Q9PVG4_CHICK CTwist OS=Gallus gallus OX=9031 GN=TWIST1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16423 COE1_HLH	41	15.4	Transcription factor COE1 helix-loop-helix domain
2	PF00010 HLH	1.5e-13	61.8	Helix-loop-helix DNA-binding domain
3	PF10961 SelK_SelG	7.9e+02	12.0	Selenoprotein SelK_SelG

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294339

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257818	0.999	Rhombotin-2
2	9606.ENSP00000262965	0.999	Transcription factor E2-alpha
3	9606.ENSP00000365858	0.999	Erythroid transcription factor
4	9606.ENSP00000392466	0.999	LIM domain-binding protein 1
5	9606.ENSP00000345681	0.997	Endothelial transcription factor GATA-2
6	9606.ENSP00000388940	0.989	Transcription factor 12
7	9606.ENSP00000383042	0.986	Lysine-specific histone demethylase 1A
8	9606.ENSP00000368632	0.985	Trans-acting T-cell-specific transcription factor GATA-3
9	9606.ENSP00000268679	0.977	Protein CBFA2T3
10	9606.ENSP00000381382	0.974	Transcription factor 4
11	9606.ENSP00000227163	0.970	Transcription factor PU.1
12	9606.ENSP00000300305	0.967	Runt-related transcription factor 1
13	9606.ENSP00000338207	0.967	Rhombotin-1
14	9606.ENSP00000339992	0.961	Transcriptional activator Myb
15	9606.ENSP00000433488	0.947	Friend leukemia integration 1 transcription factor
16	9606.ENSP00000306772	0.935	LIM domain-binding protein 2
17	9606.ENSP00000362649	0.922	Histone deacetylase 1
18	9606.ENSP00000256443	0.917	Cyclin-dependent kinase 7
19	9606.ENSP00000359357	0.908	Zinc finger protein Gfi-1
20	9606.ENSP00000256897	0.902	Cyclin-H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0070888	0.997	E-box binding
GO:0140297	0.985	DNA-binding transcription factor binding
GO:0061629	0.976	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019899	0.934	enzyme binding
GO:0000981	0.912	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042826	0.910	histone deacetylase binding
GO:0003682	0.906	chromatin binding
GO:0001228	0.492	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0009987	0.986	cellular process
GO:0010468	0.986	regulation of gene expression
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0006357	0.980	regulation of transcription by RNA polymerase II
GO:0048522	0.978	positive regulation of cellular process
GO:0032502	0.963	developmental process
GO:0048856	0.948	anatomical structure development
GO:0051173	0.939	positive regulation of nitrogen compound metabolic process
GO:0031325	0.939	positive regulation of cellular metabolic process
GO:0010604	0.937	positive regulation of macromolecule metabolic process
GO:0032501	0.929	multicellular organismal process
GO:0045935	0.929	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.925	positive regulation of biosynthetic process
GO:0045893	0.921	positive regulation of DNA-templated transcription
GO:0045944	0.911	positive regulation of transcription by RNA polymerase II
GO:0030154	0.806	cell differentiation
GO:0051239	0.689	regulation of multicellular organismal process
GO:0050793	0.621	regulation of developmental process
GO:0048519	0.528	negative regulation of biological process
GO:0048523	0.470	negative regulation of cellular process
GO:0007275	0.430	multicellular organism development
GO:0002376	0.398	immune system process
GO:0030097	0.397	hemopoiesis
GO:0050896	0.394	response to stimulus
GO:0045595	0.389	regulation of cell differentiation
GO:0008152	0.357	metabolic process
GO:0009892	0.335	negative regulation of metabolic process
GO:0031324	0.326	negative regulation of cellular metabolic process
GO:0010605	0.323	negative regulation of macromolecule metabolic process
GO:0071704	0.316	organic substance metabolic process
GO:0051172	0.313	negative regulation of nitrogen compound metabolic process
GO:0048731	0.311	system development
GO:0051094	0.309	positive regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0032991	0.995	protein-containing complex
GO:0005667	0.976	transcription regulator complex
GO:0005694	0.917	chromosome
GO:0000785	0.877	chromatin
GO:0005737	0.338	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]