StarFunc result for job id P17544

User Input

>input (483 residues)
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKN
CEEVGLFNELASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPD
SPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAP
PSNRQMGSPTGSLPLVMHLANGQTMPVLPGPPVQMPSVISLARPVSMVPNIPGIPGPPVN
SSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHP
DAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLERNRAAASRCRQKRKLWVSSL
EKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQGYLESPKESSEP
TGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQSHVIMTPQSQS
AGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17544	1.000	1.000	9.299E-73	483	1.000	1.000	P17544.pdb.gz	ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3
2	AFDB:P15336	0.299	0.289	3.835E-36	505	0.588	0.562	P15336.pdb.gz	ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4
3	AFDB:Q02930	0.208	0.199	7.916E-24	508	0.455	0.433	Q02930.pdb.gz	CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens OX=9606 GN=CREB5 PE=1 SV=3
4	AFDB:Q4H3W1	0.180	0.140	2.713E-14	631	0.331	0.254	Q4H3W1.pdb.gz	Q4H3W1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF2/7 PE=1 SV=1
5	AFDB:Q54WN7	0.155	0.122	8.679E-5	631	0.164	0.125	Q54WN7.pdb.gz	BZPF_DICDI Probable basic-leucine zipper transcription factor F OS=Dictyostelium discoideum OX=44689 GN=bzpF PE=3 SV=1
6	AFDB:P52890	0.184	0.159	1.405E-4	566	0.178	0.152	P52890.pdb.gz	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
7	AFDB:Q9NJH7	0.126	0.060	1.405E-4	1144	0.135	0.057	Q9NJH7.pdb.gz	Q9NJH7_DROME Eukaryotic translation initiation factor 5B OS=Drosophila melanogaster OX=7227 GN=eIF5B PE=2 SV=1
8	AFDB:Q9GYQ9	0.088	0.057	1.108E-3	796	0.182	0.111	Q9GYQ9.pdb.gz	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
9	AFDB:Q99941	0.150	0.108	1.563E-3	703	0.178	0.122	Q99941.pdb.gz	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
10	AFDB:Q6WKW9	0.086	0.076	4.387E-3	554	0.149	0.130	Q6WKW9.pdb.gz	HMGX4_XENLA HMG box-containing protein 4 OS=Xenopus laevis OX=8355 GN=hmgxb4 PE=1 SV=1
11	PDB:4v6wCW	0.072	0.224	3.361	130	0.041	0.154	4v6wCW.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:5ijnH	0.128	0.322	3.857	169	0.050	0.142	5ijnH.pdb.gz
13	PDB:7vciU	0.077	0.048	5.080	820	0.033	0.020	7vciU.pdb.gz
14	PDB:5nrlV	0.077	0.249	5.442	127	0.035	0.134	5nrlV.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:4uhvB	0.060	0.050	5.829	645	0.033	0.025	4uhvB.pdb.gz
16	PDB:6o9lQ	0.058	0.063	7.677	430	0.037	0.042	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
17	PDB:7ls2V2	0.059	0.183	8.223	117	0.035	0.145	7ls2V2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
18	PDB:7pzyl	0.064	0.078	9.437	361	0.023	0.030	7pzyl.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17544	0.0	974	483	1.000	1.000	ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3
2	Q8R0S1	0.0	821	413	0.828	0.969	ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus OX=10090 GN=Atf7 PE=1 SV=1
3	P16951	1.43e-164	476	487	0.594	0.589	ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus OX=10090 GN=Atf2 PE=1 SV=2
4	P15336	1.11e-163	474	505	0.590	0.564	ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4
5	Q00969	1.48e-163	473	487	0.590	0.585	ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus OX=10116 GN=Atf2 PE=1 SV=2
6	B8ZZU6	6.91e-76	245	389	0.308	0.383	B8ZZU6_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=1
7	Q8K1L0	5.86e-50	176	357	0.211	0.286	CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus OX=10090 GN=Creb5 PE=2 SV=3
8	Q02930	1.32e-49	179	508	0.244	0.232	CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens OX=9606 GN=CREB5 PE=1 SV=3
9	A7S1A3	5.30e-35	132	222	0.159	0.347	A7S1A3_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g34679 PE=1 SV=1
10	Q4H3W1	5.36e-28	119	631	0.106	0.081	Q4H3W1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF2/7 PE=1 SV=1
11	P52890	1.72e-20	96.7	566	0.087	0.074	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
12	C8VJ72	2.96e-20	95.5	485	0.093	0.093	C8VJ72_EMENI AtfA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02911 PE=4 SV=1
13	P78962	7.41e-17	84.0	355	0.095	0.130	ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf21 PE=3 SV=1
14	A0A0F0IP79	1.06e-11	68.2	318	0.077	0.116	ATFB_ASPPU Basic leucine zipper (bZIP) transcription factor atfB OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=atfB PE=1 SV=1
15	Q2U616	4.59e-11	66.2	318	0.064	0.097	ATFB_ASPOR Basic leucine zipper (bZIP) transcription factor atfB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atfB PE=2 SV=1
16	P15066	2.52e-10	64.3	341	0.070	0.100	JUND_MOUSE Transcription factor JunD OS=Mus musculus OX=10090 GN=Jund PE=1 SV=1
17	P52909	2.52e-10	64.3	341	0.070	0.100	JUND_RAT Transcription factor JunD OS=Rattus norvegicus OX=10116 GN=Jund PE=1 SV=1
18	P17535	2.93e-10	63.9	347	0.070	0.098	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3
19	Q09771	1.15e-09	60.5	209	0.064	0.148	ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf31 PE=3 SV=1
20	Q09926	1.23e-09	59.7	171	0.068	0.193	PCR1_SCHPO Transcription factor pcr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	5.5e-09	47.3	bZIP transcription factor
2	PF07716 bZIP_2	3e-05	35.3	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.62	22.0	bZIP Maf transcription factor
4	PF07989 Cnn_1N	94	14.6	Centrosomin N-terminal motif 1
5	PF00096 zf-C2H2	6.9	18.5	Zinc finger, C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306245	0.942	Proto-oncogene c-Fos
2	9606.ENSP00000360266	0.896	Transcription factor AP-1
3	9606.ENSP00000264716	0.895	Fos-related antigen 2
4	9606.ENSP00000350359	0.883	Cyclic AMP-responsive element-binding protein 5
5	9606.ENSP00000359685	0.842	Protein tyrosine phosphatase type IVA 1
6	9606.ENSP00000303315	0.809	Transcription factor jun-B
7	9606.ENSP00000263974	0.801	Transcription initiation factor TFIID subunit 12
8	9606.ENSP00000264110	0.792	Cyclic AMP-dependent transcription factor ATF-2
9	9606.ENSP00000271640	0.728	Histone-lysine N-methyltransferase SETDB1
10	9606.ENSP00000440440	0.696	Activating transcription factor 7-interacting protein 1
11	9606.ENSP00000394560	0.660	Mitogen-activated protein kinase 9
12	9606.ENSP00000382805	0.657	Transcription regulator protein BACH1
13	9606.ENSP00000396954	0.652	Cyclic AMP-dependent transcription factor ATF-5
14	9606.ENSP00000265339	0.633	Ubiquitin-conjugating enzyme E2 B
15	9606.ENSP00000378974	0.617	Mitogen-activated protein kinase 8
16	9606.ENSP00000252818	0.604	Transcription factor jun-D
17	9606.ENSP00000387699	0.595	Cyclic AMP-responsive element-binding protein 1
18	9606.ENSP00000409463	0.595	Zinc finger protein 740
19	9606.ENSP00000267569	0.579	Jun dimerization protein 2
20	9606.ENSP00000366233	0.578	Gamma-aminobutyric acid type B receptor subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.991	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0019901	0.989	protein kinase binding
GO:0001221	0.982	transcription coregulator binding
GO:0051019	0.855	mitogen-activated protein kinase binding
GO:0001223	0.799	transcription coactivator binding
GO:0001228	0.600	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0046983	0.302	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0080090	0.997	regulation of primary metabolic process
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0009889	0.996	regulation of biosynthetic process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0009987	0.969	cellular process
GO:0009893	0.965	positive regulation of metabolic process
GO:0048522	0.959	positive regulation of cellular process
GO:0048519	0.933	negative regulation of biological process
GO:0031328	0.930	positive regulation of cellular biosynthetic process
GO:0045893	0.921	positive regulation of DNA-templated transcription
GO:1903507	0.917	negative regulation of nucleic acid-templated transcription
GO:0045892	0.905	negative regulation of DNA-templated transcription
GO:0006357	0.903	regulation of transcription by RNA polymerase II
GO:0050896	0.887	response to stimulus
GO:0045944	0.880	positive regulation of transcription by RNA polymerase II
GO:0000122	0.782	negative regulation of transcription by RNA polymerase II
GO:0008152	0.756	metabolic process
GO:0071704	0.632	organic substance metabolic process
GO:0044238	0.622	primary metabolic process
GO:0051716	0.606	cellular response to stimulus
GO:0006950	0.583	response to stress
GO:0006807	0.540	nitrogen compound metabolic process
GO:0043170	0.483	macromolecule metabolic process
GO:0044237	0.436	cellular metabolic process
GO:0007154	0.434	cell communication
GO:0033554	0.424	cellular response to stress
GO:0007165	0.406	signal transduction
GO:1901564	0.337	organonitrogen compound metabolic process
GO:0043412	0.336	macromolecule modification
GO:0019538	0.327	protein metabolic process
GO:0032502	0.326	developmental process
GO:0036211	0.318	protein modification process
GO:0042221	0.309	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005667	0.960	transcription regulator complex
GO:0140513	0.945	nuclear protein-containing complex
GO:0090575	0.938	RNA polymerase II transcription regulator complex
GO:0005737	0.737	cytoplasm
GO:0043232	0.735	intracellular non-membrane-bounded organelle
GO:0005694	0.486	chromosome
GO:0016020	0.362	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]