StarFunc result for job id P17612

User Input

>input (351 residues)
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1SD45	1.000	1.000	4.595E-66	351	0.994	0.994	F1SD45.pdb.gz	F1SD45_PIG cAMP-dependent protein kinase OS=Sus scrofa OX=9823 GN=PRKACA PE=3 SV=1
2	AFDB:P22612	0.996	0.996	5.753E-59	351	0.829	0.829	P22612.pdb.gz	KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens OX=9606 GN=PRKACG PE=1 SV=3
3	PDB:6byrA	0.962	0.835	8.153E-59	405	0.960	0.832	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
4	AFDB:P12370	0.983	0.977	1.356E-58	353	0.821	0.816	P12370.pdb.gz	KAPC1_DROME cAMP-dependent protein kinase catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=Pka-C1 PE=1 SV=3
5	AFDB:P21137	0.933	0.812	1.523E-52	404	0.764	0.663	P21137.pdb.gz	KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=kin-1 PE=1 SV=3
6	PDB:5x3fB	0.841	0.846	7.821E-51	349	0.838	0.842	5x3fB.pdb.gz
7	AFDB:A0A024RBU5	0.878	0.861	2.377E-41	358	0.476	0.466	A0A024RBU5.pdb.gz
8	AFDB:Q9HFW0	0.860	0.592	2.791E-41	515	0.524	0.357	Q9HFW0.pdb.gz	Q9HFW0_CRYNE cAMP dependent protein kinase catalytic subunit OS=Cryptococcus neoformans var. neoformans OX=40410 GN=PKA1 PE=4 SV=1
9	AFDB:Q922R0	0.875	0.865	2.511E-40	355	0.476	0.470	Q922R0.pdb.gz	PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus OX=10090 GN=Prkx PE=1 SV=1
10	AFDB:P06244	0.875	0.777	3.654E-40	397	0.462	0.408	P06244.pdb.gz	KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPK1 PE=1 SV=3
11	AFDB:P06245	0.888	0.822	4.777E-40	380	0.473	0.437	P06245.pdb.gz	KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPK2 PE=1 SV=2
12	AFDB:P16912	0.865	0.525	2.384E-39	583	0.481	0.290	P16912.pdb.gz	KAPC3_DROME cAMP-dependent protein kinase catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=Pka-C3 PE=2 SV=2
13	PDB:3pfqA	0.768	0.519	1.806E-28	523	0.330	0.222	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
14	PDB:5dykA	0.767	0.340	1.806E-28	809	0.328	0.142	5dykA.pdb.gz
15	PDB:3c4wB	0.794	0.546	1.383E-27	519	0.308	0.208	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
16	PDB:6pjxA	0.813	0.534	2.364E-27	543	0.276	0.179	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
17	PDB:6s9wA	0.696	0.600	2.631E-27	411	0.379	0.324	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:4yhjA	0.798	0.570	1.118E-26	501	0.291	0.204	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	PDB:6hhgA	0.684	0.625	1.385E-26	386	0.348	0.316	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:3pvuA	0.747	0.440	2.127E-26	609	0.265	0.153	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SD45	0.0	726	351	0.994	0.994	F1SD45_PIG cAMP-dependent protein kinase OS=Sus scrofa OX=9823 GN=PRKACA PE=3 SV=1
2	G1SK25	0.0	653	338	0.895	0.929	G1SK25_RABIT cAMP-dependent protein kinase OS=Oryctolagus cuniculus OX=9986 GN=PRKACB PE=3 SV=3
3	P00517	0.0	726	351	0.994	0.994	KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus OX=9913 GN=PRKACA PE=1 SV=3
4	P05132	0.0	718	351	0.980	0.980	KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus OX=10090 GN=Prkaca PE=1 SV=3
5	P12370	0.0	616	353	0.829	0.824	KAPC1_DROME cAMP-dependent protein kinase catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=Pka-C1 PE=1 SV=3
6	P17612	0.0	729	351	1.000	1.000	KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2
7	P21137	0.0	563	404	0.766	0.666	KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=kin-1 PE=1 SV=3
8	P22612	0.0	625	351	0.829	0.829	KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens OX=9606 GN=PRKACG PE=1 SV=3
9	P22694	0.0	679	351	0.929	0.929	KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB PE=1 SV=2
10	P27791	0.0	717	351	0.980	0.980	KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus OX=10116 GN=Prkaca PE=1 SV=2
11	P36887	0.0	724	351	0.991	0.991	KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa OX=9823 GN=PRKACA PE=1 SV=4
12	P68181	0.0	672	351	0.923	0.923	KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus OX=10090 GN=Prkacb PE=1 SV=2
13	P68182	0.0	672	351	0.923	0.923	KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus OX=10116 GN=Prkacb PE=1 SV=2
14	P51817	8.04e-128	372	358	0.470	0.461	PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens OX=9606 GN=PRKX PE=1 SV=1
15	P16912	6.74e-127	377	583	0.476	0.286	KAPC3_DROME cAMP-dependent protein kinase catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=Pka-C3 PE=2 SV=2
16	Q9HFW0	1.70e-126	374	515	0.490	0.334	Q9HFW0_CRYNE cAMP dependent protein kinase catalytic subunit OS=Cryptococcus neoformans var. neoformans OX=40410 GN=PKA1 PE=4 SV=1
17	Q922R0	2.63e-125	365	355	0.499	0.493	PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus OX=10090 GN=Prkx PE=1 SV=1
18	A0A1D8PHU1	9.34e-124	363	413	0.481	0.409	A0A1D8PHU1_CANAL cAMP-dependent protein kinase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPK2 PE=3 SV=1
19	P34099	1.95e-123	371	648	0.479	0.259	KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum OX=44689 GN=pkaC PE=1 SV=2
20	Q38DS1	4.28e-122	357	336	0.473	0.494	Q38DS1_TRYB2 Protein kinase A catalytic subunit isoform 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2360 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.096	23.3	ABC1 atypical kinase-like domain
2	PF01636 APH	46	15.3	Phosphotransferase enzyme family
3	PF14531 Kinase-like	1.7e-05	35.9	Kinase-like
4	PF00069 Pkinase	4.7e-70	247.6	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	3.5e-31	120.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008564241.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008566276.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 14 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008564030.1	0.997	cAMP-dependent protein kinase type II-alpha regulatory subunit-like
3	482537.XP_008567594.1	0.997	cAMP-dependent protein kinase type I-alpha regulatory subunit
4	482537.XP_008574489.1	0.997	cAMP-dependent protein kinase inhibitor alpha
5	482537.XP_008576643.1	0.996	cAMP-dependent protein kinase type I-beta regulatory subunit-like
6	482537.XP_008579293.1	0.993	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
7	482537.XP_008576607.1	0.977	cGMP-specific 3',5'-cyclic phosphodiesterase
8	482537.XP_008585889.1	0.973	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 47 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008581487.1	0.970	Cardiac phospholamban
10	482537.XP_008565758.1	0.964	cAMP-specific 3',5'-cyclic phosphodiesterase 4D isoform X1
11	482537.XP_008569833.1	0.964	cAMP-dependent protein kinase catalytic subunit beta isoform X1
12	482537.XP_008573785.1	0.963	Nuclear inhibitor of protein phosphatase 1
13	482537.XP_008580911.1	0.959	Microtubule-associated protein tau
14	482537.XP_008573802.1	0.947	Adenylate cyclase type 10
15	482537.XP_008567455.1	0.945	Ryanodine receptor 2 isoform X1
16	482537.XP_008567458.1	0.945	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 83% coverage of the annotated genomic feature by RNAseq alignments
17	482537.XP_008565639.1	0.940	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	482537.XP_008581304.1	0.931	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 8 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	482537.XP_008565156.1	0.930	5'-AMP-activated protein kinase catalytic subunit alpha-1
20	482537.XP_008581246.1	0.929	5'-AMP-activated protein kinase subunit beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004691	1.000	cAMP-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0016310	0.979	phosphorylation
GO:0050896	0.961	response to stimulus
GO:0071704	0.951	organic substance metabolic process
GO:1901564	0.944	organonitrogen compound metabolic process
GO:0043412	0.937	macromolecule modification
GO:0044238	0.936	primary metabolic process
GO:0006468	0.934	protein phosphorylation
GO:0007154	0.789	cell communication
GO:0051716	0.772	cellular response to stimulus
GO:0023052	0.739	signaling
GO:0048519	0.735	negative regulation of biological process
GO:0007165	0.621	signal transduction
GO:0018105	0.619	peptidyl-serine phosphorylation
GO:0032501	0.614	multicellular organismal process
GO:0048518	0.587	positive regulation of biological process
GO:0048523	0.587	negative regulation of cellular process
GO:0019222	0.520	regulation of metabolic process
GO:0048522	0.474	positive regulation of cellular process
GO:0060255	0.459	regulation of macromolecule metabolic process
GO:0051171	0.458	regulation of nitrogen compound metabolic process
GO:0080090	0.456	regulation of primary metabolic process
GO:0031323	0.434	regulation of cellular metabolic process
GO:0009893	0.392	positive regulation of metabolic process
GO:0048583	0.363	regulation of response to stimulus
GO:0032502	0.337	developmental process
GO:0010646	0.324	regulation of cell communication
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0071840	0.319	cellular component organization or biogenesis
GO:0023051	0.319	regulation of signaling
GO:0042221	0.307	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0032991	0.996	protein-containing complex
GO:0016020	0.990	membrane
GO:0005654	0.985	nucleoplasm
GO:1902494	0.973	catalytic complex
GO:0005829	0.972	cytosol
GO:0071944	0.949	cell periphery
GO:0043228	0.911	non-membrane-bounded organelle
GO:0005886	0.904	plasma membrane
GO:1902554	0.899	serine/threonine protein kinase complex
GO:0005952	0.894	cAMP-dependent protein kinase complex
GO:0043232	0.893	intracellular non-membrane-bounded organelle
GO:0097546	0.815	ciliary base
GO:0031982	0.699	vesicle
GO:0012505	0.470	endomembrane system
GO:0005856	0.366	cytoskeleton
GO:0005576	0.316	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.11	1.000	cAMP-dependent protein kinase.

[back to server]