StarFunc result for job id P17643

User Input

>input (537 residues)
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSS
GRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQ
EPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIA
IAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17643	1.000	1.000	0.000	537	1.000	1.000	P17643.pdb.gz	TYRP1_HUMAN 5,6-dihydroxyindole-2-carboxylic acid oxidase OS=Homo sapiens OX=9606 GN=TYRP1 PE=1 SV=2
2	AFDB:P07147	0.902	0.902	4.575E-97	537	0.853	0.853	P07147.pdb.gz	TYRP1_MOUSE 5,6-dihydroxyindole-2-carboxylic acid oxidase OS=Mus musculus OX=10090 GN=Tyrp1 PE=1 SV=1
3	AFDB:Q6DGE4	0.876	0.894	1.001E-80	526	0.655	0.669	Q6DGE4.pdb.gz	Q6DGE4_DANRE 5,6-dihydroxyindole-2-carboxylic acid oxidase precursor OS=Danio rerio OX=7955 GN=hm:zeh0659 PE=1 SV=1
4	AFDB:A9JSV0	0.882	0.816	2.290E-79	582	0.650	0.600	A9JSV0.pdb.gz
5	AFDB:P29812	0.819	0.850	3.316E-61	517	0.471	0.489	P29812.pdb.gz	TYRP2_MOUSE L-dopachrome tautomerase OS=Mus musculus OX=10090 GN=Dct PE=1 SV=2
6	AFDB:P40126	0.827	0.855	5.800E-61	519	0.467	0.484	P40126.pdb.gz	TYRP2_HUMAN L-dopachrome tautomerase OS=Homo sapiens OX=9606 GN=DCT PE=1 SV=1
7	AFDB:L8B082	0.808	0.820	4.769E-53	529	0.389	0.395	L8B082.pdb.gz	L8B082_HUMAN Tyrosinase OS=Homo sapiens OX=9606 GN=TYR PE=2 SV=1
8	AFDB:F1QDZ4	0.801	0.804	5.640E-53	535	0.385	0.387	F1QDZ4.pdb.gz
9	AFDB:Q0MVP0	0.794	0.801	1.305E-52	532	0.367	0.370	Q0MVP0.pdb.gz	TYRO_PELLE Tyrosinase OS=Pelophylax lessonae OX=45623 GN=Tyr PE=1 SV=1
10	AFDB:P11344	0.795	0.801	7.805E-52	533	0.380	0.383	P11344.pdb.gz	TYRO_MOUSE Tyrosinase OS=Mus musculus OX=10090 GN=Tyr PE=1 SV=3
11	PDB:4j3rA	0.400	0.556	3.374E-9	372	0.119	0.172	4j3rA.pdb.gz	The crystal structure of an extracellular catechol oxidase from the ascomycete fungus Aspergillus oryzae.
12	PDB:1oxyA	0.212	0.201	1.896E-2	573	0.063	0.059	1oxyA.pdb.gz	Crystallographic analysis of oxygenated and deoxygenated states of arthropod hemocyanin shows unusual differences.
13	PDB:3hhsA	0.186	0.155	1.341E-1	669	0.071	0.057	3hhsA.pdb.gz	Crystal structure of Manduca sexta prophenoloxidase provides insights into the mechanism of type 3 copper enzymes.
14	PDB:3hhsB	0.206	0.174	1.418E-1	656	0.076	0.062	3hhsB.pdb.gz	Crystal structure of Manduca sexta prophenoloxidase provides insights into the mechanism of type 3 copper enzymes.
15	PDB:4g1eB	0.043	0.036	1.255	709	0.043	0.032	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
16	PDB:1ainA	0.097	0.133	2.903	314	0.050	0.086	1ainA.pdb.gz
17	PDB:6ncfB	0.077	0.064	3.839	676	0.035	0.028	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
18	PDB:6h62A	0.097	0.128	5.078	370	0.078	0.114	6h62A.pdb.gz	Structural and Biochemical Investigation of the Heterodimeric Murine tRNA-Guanine Transglycosylase.
19	PDB:7n15A	0.064	0.065	6.715	520	0.037	0.038	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
20	PDB:7q3nU	0.042	0.066	7.101	292	0.034	0.062	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QEC9	0.0	750	524	0.655	0.672	F1QEC9_DANRE 5,6-dihydroxyindole-2-carboxylic acid oxidase isoform X1 OS=Danio rerio OX=7955 GN=tyrp1a PE=1 SV=2
2	P07147	0.0	947	537	0.853	0.853	TYRP1_MOUSE 5,6-dihydroxyindole-2-carboxylic acid oxidase OS=Mus musculus OX=10090 GN=Tyrp1 PE=1 SV=1
3	P17643	0.0	1123	537	1.000	1.000	TYRP1_HUMAN 5,6-dihydroxyindole-2-carboxylic acid oxidase OS=Homo sapiens OX=9606 GN=TYRP1 PE=1 SV=2
4	Q6DGE4	0.0	732	526	0.657	0.671	Q6DGE4_DANRE 5,6-dihydroxyindole-2-carboxylic acid oxidase precursor OS=Danio rerio OX=7955 GN=hm:zeh0659 PE=1 SV=1
5	P40126	1.61e-174	504	519	0.477	0.493	TYRP2_HUMAN L-dopachrome tautomerase OS=Homo sapiens OX=9606 GN=DCT PE=1 SV=1
6	P29812	9.65e-172	497	517	0.447	0.464	TYRP2_MOUSE L-dopachrome tautomerase OS=Mus musculus OX=10090 GN=Dct PE=1 SV=2
7	D4A9G4	2.33e-138	412	530	0.397	0.402	D4A9G4_RAT Tyrosinase OS=Rattus norvegicus OX=10116 GN=Tyr PE=3 SV=1
8	L8B082	7.30e-137	409	529	0.412	0.418	L8B082_HUMAN Tyrosinase OS=Homo sapiens OX=9606 GN=TYR PE=2 SV=1
9	P14679	7.30e-137	409	529	0.412	0.418	TYRO_HUMAN Tyrosinase OS=Homo sapiens OX=9606 GN=TYR PE=1 SV=3
10	P11344	9.90e-135	403	533	0.404	0.407	TYRO_MOUSE Tyrosinase OS=Mus musculus OX=10090 GN=Tyr PE=1 SV=3
11	Q0MVP0	1.12e-127	385	532	0.387	0.391	TYRO_PELLE Tyrosinase OS=Pelophylax lessonae OX=45623 GN=Tyr PE=1 SV=1
12	B1VTI5	2.04e-20	94.4	306	0.160	0.281	GRIF_STRGG Grixazone synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) OX=455632 GN=griF PE=1 SV=1
13	P34269	2.91e-07	55.5	601	0.112	0.100	TYR1_CAEEL Putative tyrosinase-like protein tyr-1 OS=Caenorhabditis elegans OX=6239 GN=tyr-1 PE=1 SV=2
14	Q9XUS8	1.13e-05	50.4	681	0.091	0.072	Q9XUS8_CAEEL ShKT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tyr-2 PE=1 SV=1
15	Q5AQP2	0.001	43.5	340	0.110	0.174	Q5AQP2_EMENI Tyrosinase copper-binding domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09388 PE=4 SV=1
16	C0LU17	0.029	39.7	603	0.026	0.023	C0LU17_JUGRE Polyphenol oxidase OS=Juglans regia OX=51240 GN=PPO1 PE=1 SV=1
17	O81103	0.055	38.5	597	0.032	0.028	PPO_PRUAR Polyphenol oxidase latent form, chloroplastic OS=Prunus armeniaca OX=36596 GN=PPO PE=1 SV=1
18	Q6UIL3	0.14	37.4	584	0.030	0.027	LAHY_LARTR (+)-larreatricin hydroxylase, chloroplastic OS=Larrea tridentata OX=66636 PE=1 SV=1
19	Q9ZP19	0.25	36.6	496	0.024	0.026	PPO1_IPOBA Polyphenol oxidase I, chloroplastic OS=Ipomoea batatas OX=4120 GN=co-1 PE=1 SV=1
20	P25371	0.35	36.2	1049	0.048	0.025	ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11174 DUF2970	2.7e+02	12.8	Protein of unknown function (DUF2970)
2	PF00264 Tyrosinase	3e-31	121.0	Common central domain of tyrosinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392762	0.956	L-dopachrome tautomerase
2	9606.ENSP00000247461	0.933	Calnexin
3	9606.ENSP00000296589	0.929	Membrane-associated transporter protein
4	9606.ENSP00000402758	0.911	Melanocyte protein PMEL
5	9606.ENSP00000295600	0.905	Microphthalmia-associated transcription factor
6	9606.ENSP00000370886	0.904	Melanoma antigen recognized by T-cells 1
7	9606.ENSP00000419313	0.900	Short transient receptor potential channel 1
8	9606.ENSP00000263321	0.897	Tyrosinase
9	9606.ENSP00000346659	0.887	P protein
10	9606.ENSP00000376753	0.879	PDZ domain-containing protein GIPC1
11	9606.ENSP00000451605	0.855	Melanocyte-stimulating hormone receptor
12	9606.ENSP00000341550	0.847	Sodium/potassium/calcium exchanger 5
13	9606.ENSP00000454804	0.763	Agouti-signaling protein
14	9606.ENSP00000371420	0.728	Transmembrane glycoprotein NMB
15	9606.ENSP00000380093	0.704	Transcription factor SOX-10
16	9606.ENSP00000417161	0.701	G-protein coupled receptor 143
17	9606.ENSP00000347872	0.699	Synaptic vesicle membrane protein VAT-1 homolog
18	9606.ENSP00000243662	0.696	Ras-related protein Rab-38
19	9606.ENSP00000332353	0.693	Protein patched homolog 1
20	9606.ENSP00000345672	0.690	Cathepsin B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004497	1.000	monooxygenase activity
GO:0016705	0.987	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016716	0.964	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen
GO:0042802	0.934	identical protein binding
GO:0046983	0.886	protein dimerization activity
GO:0042803	0.707	protein homodimerization activity
GO:0004503	0.597	tyrosinase activity
GO:0043167	0.394	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0008152	0.986	metabolic process
GO:0071704	0.966	organic substance metabolic process
GO:0046189	0.964	phenol-containing compound biosynthetic process
GO:0042440	0.963	pigment metabolic process
GO:0046148	0.948	pigment biosynthetic process
GO:0050789	0.937	regulation of biological process
GO:0006582	0.936	melanin metabolic process
GO:0071840	0.905	cellular component organization or biogenesis
GO:0016043	0.902	cellular component organization
GO:0043473	0.895	pigmentation
GO:0050794	0.880	regulation of cellular process
GO:0044238	0.833	primary metabolic process
GO:0006807	0.823	nitrogen compound metabolic process
GO:0032502	0.810	developmental process
GO:0048518	0.806	positive regulation of biological process
GO:0019222	0.758	regulation of metabolic process
GO:1901564	0.745	organonitrogen compound metabolic process
GO:0009889	0.655	regulation of biosynthetic process
GO:0009893	0.654	positive regulation of metabolic process
GO:0044550	0.639	secondary metabolite biosynthetic process
GO:0050896	0.623	response to stimulus
GO:0009891	0.590	positive regulation of biosynthetic process
GO:0009072	0.571	aromatic amino acid metabolic process
GO:0031323	0.560	regulation of cellular metabolic process
GO:0006570	0.549	tyrosine metabolic process
GO:0048522	0.511	positive regulation of cellular process
GO:0043455	0.498	regulation of secondary metabolic process
GO:1900376	0.454	regulation of secondary metabolite biosynthetic process
GO:1900378	0.431	positive regulation of secondary metabolite biosynthetic process
GO:0033059	0.351	cellular pigmentation
GO:0006996	0.345	organelle organization
GO:0048066	0.344	developmental pigmentation
GO:0060255	0.337	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042470	0.998	melanosome
GO:0031090	0.997	organelle membrane
GO:0098588	0.988	bounding membrane of organelle
GO:0030659	0.976	cytoplasmic vesicle membrane
GO:0045009	0.934	chitosome
GO:0090741	0.886	pigment granule membrane
GO:0071944	0.833	cell periphery
GO:0005886	0.749	plasma membrane
GO:0012505	0.656	endomembrane system
GO:0033162	0.538	melanosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.
EC:1.14.-.-	0.987	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.18.-	0.964	With another compound as one donor, and incorporation of one atom of oxygen.
EC:1.14.18.1	0.597	tyrosinase.

[back to server]